Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000005621 (Zfp592)
Chromosomal location
Chr 7: 88138570 - 88190050 (+)
Description
zinc finger protein 592 Gene [Source:MGI (curated);Acc:Zfp592-001]
RefSeq_dna
NM_178707 
RefSeq_peptide
NP_848822.1 
UniGene
Mm.29525 Mm.392676 
MGI
MGI:2443541 
Uniprot/SWISSPROT
Q8BHZ4 
Uniprot/SPTREMBL
Q0VF56 Q52KI9 Q3UPC8 
Human Ortholog
ENSG00000166716 (ZNF592)
Omim not available
UniTrap UNI27510
Vector Insertion
Chr 7: 88138649 - 88154319
Public Clones IST14958E10 (tigm) IST14431A5 (tigm)
Private Clones OST57827 (lexicon) OST54224 (lexicon) OST43733 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3019
Vector Insertion
Chr 7: 88154426 - 88168156
Public Clones AZ0138 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30237
Vector Insertion
Chr 7: 88154426 - 88168156
Public Clones (sanger) D068E09 (ggtc) IST14346H9 (tigm) IST11560F1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16019
Vector Insertion
Chr 7: 88168156 - 88170396
Public Clones not available
Private Clones OST467821 (lexicon) OST464638 (lexicon) OST462880 (lexicon) OST454755 (lexicon)
OST450013 (lexicon) OST448507 (lexicon) OST442466 (lexicon) OST433242 (lexicon)
OST389292 (lexicon) OST385519 (lexicon) OST369360 (lexicon) OST368863 (lexicon)
OST354844 (lexicon) OST332369 (lexicon) OST325411 (lexicon) OST319261 (lexicon)
OST313733 (lexicon) OST307659 (lexicon) OST288982 (lexicon) OST249156 (lexicon)
OST241449 (lexicon) OST225860 (lexicon) OST216724 (lexicon) OST195628 (lexicon)
OST164857 (lexicon) OST135508 (lexicon) OST123579 (lexicon) OST101513 (lexicon)
OST90308 (lexicon) OST82449 (lexicon) OST78798 (lexicon) OST66112 (lexicon)
OST55249 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16444
Vector Insertion
Chr 7: 88170396 - 88174334
Public Clones (sanger)
Private Clones OST461183 (lexicon)
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000005761
Sequence
GTGGCTCCCGCAGCCGGCGCTGGGGACGCGCGCGGCCGAGCCCGGGGCCTGTCGCTGCCGCCGCCGCCGCCGCCGCCAG - UNI27510 - GTGGTGA

CTGGACTCTAGACCATGTGCCTAGGTAGTTTTTCCCTTCTCCGCAGCTCTGCTTCCCCAGCAACGCTCACCACACCCTTGTTTTGAGAACCTCACTAAG 

- UNI3019 - - UNI16019 - - UNI30237 - TACTTGTCAGCATCCAGCCATGGGGGATATGAAAACTCCAGATTTTGATGATCTCCTGGCTG

CCTTTGACATCCCAGATCCCACAAGTCTTGATGCAAAGGAGGCCATCCAGGCTCCCAGTGAGGAGAATGAGAGTCCCCTGAAGTCTTCAGGCATGTGTAT

CGATGAGAATGTGTCCTTGTCGCACTCAGGATCAGCCCCAGATGTGCCAGCCGTGAGTGTCATTGTCAAGAACACCAGCCGCCAAGAGTCGTTTGAAGCA

GAGAAAGACCACATTGCTCCCAGTCTCCTACATAATGGATTCCGGGGCTCAGACCTGCCCCCAGACTCCCACCACTGTGGGAAGTTTGATTCTACTTTTA

TAAATGGAGACAGTGCTAGGAGTTTCACAAGCAAGCTAGAGCCTTCCAAGTCGGAGCCATTACCCACCTTCAACCAGTTCAGCCCAATCTCTAGCCCAGA

GCCTGAGGATCCTGTCAAAGATAATGGGTTTGGGATAAAGTCCAAGCACTCTGACAGTTATTTCCCACCTCCTCCTGGGACTGTGGGAGGCCCAGTCCTG

GAAGCTCTGTCAAAATTCCCAGTCCCGGAACTACACATGTTTGATCACTTTTGTAAGAAAGAACCTAAACCAGAACCCTTGCCTTTAGAGAGCCAGCAGG

AGCATGAGCAGGGTGGGCAGAAGGTGGTGGAGCCTCACAAAGATCTGGATTCCAGTCGGTTCTTTGGGGAAGCTTTAGAGTTCAATAGTCACCCTAGCAA

CAGTATTGGAGAGCCCAAGAAGCTTGCTCCAGAGCTTAGTGCTTGCTCCTCTGTCCCTCCTAGGCAGCGTCTGAAGCCAGCCCATTCCAAGTTATCCTCT

TGTGTTGCAGCCTTGGTGGCCTTACAGGCCAAAAGGGTGGCCAATGTCACCAAAGAGGATCAGCCTGGTCACACAAAGGATTCCTCAGGGCCCACTAAAG

AGGGTTCTAAAGGCAGCCCCAAAATGCCCAAGTCACCAAAGAGTCCCCGGAGCCCTCTAGAGGCCACTAGAAAAAGTATCAAGCCATCTGATAGCCCTCG

GAGCATCTGCAGTGACAGCAGCAGCAAAGGGTCTCCTTCTGTGGCTGCCAGCTCCCCACCAGCAATTCCCAAAGTCAGAATCAAAACAATTAAGACATCA

TCGGGGGAAATCAAACGGACGGTTACCAGGATCCTGCCAGACCCTGATGATCCAAGCAAGTCCCCTGCTGAGTCCCCTGCAGGGAGCACAATCACTGAGG

CTCCAAGTGAGGCACCAGGGGATGAAGGCACAGCCATGCCTGTGGAAGAGCACTTTTCTGAGGCAGGCATACATTCAGGGAGCCCCCAGGGTGACAGAAA

AGGGGATGAGAATATGATCAAAACCAGTGACTCTTCATCTCCCTGCCGCATCTCTGGGTCCAGGGTCCCAAAAGGATCTGCCCTGAACTCACAGGCAAGC

AAGAAGCAACAGAGCACAGCACCTCAGGCATCAACCCCCGCTGCCAGTCTCTTGCCCAAAGCTGTGCACTTGGCCAACTTGAACTTGGTCCCCCACAGTG

TTGCCGCATCTGTGACTGCCAAGTCCTCAGCACAGAGACGGAGCCAGCCTCAGGTCACGCAAATGACAGTGCCCCTGGTCCACCAGGTGAAAAAGGCCGC

CCCTCTAATTGTGGAGGTCTTCAACAAGGTCCTTCACAGCTCTAACCCTGTGCCCCTCTATGCGCCAAATCTCAGCCCACCTGCAGACAGCAGAATCCAC

GTGCCGGCCAGTGGGTACTGCTGCCTGGAGTGCGGAGACGCGTTTGCCTTAGAGAAGAGCCTGAGCCAGCACTATAGCCGGCGCAGTGTCCACATTGAGG

TGCTGTGCACACTGTGCTCTAAGACACTGCTCTTCTTCAACAAGTGCAGTCTGCTTCGGCATGCCCGTGACCACAAGAGCAAGGGACTTGTCATGCAGTG

CTCTCAGCTGCTTGTGAAGCCCATCTCTGCGGACCAGATGTTTGTGGCGGCTCCCGTGAACTCCACTGCACCAGCAACCCCAGCCGCTTCTTCCTCCCCC

AAACCCAGCCCCACTTTGGACAATGCCAGCTCTGTAATTCCAGCCTTGCCACTTTATCCAGACCCAGTGAGGCTCATCCGGTATGGAACCAAATGTCCTG

AGTGTCACAAGCAGATGCGAGATTATATGGTCCTGGCTACACATTTCCAGAGGACAACAGAGGAAACCGAGGGGCTA - UNI16019 - - UNI1644

4 - ACTTGTCAGGTATGCCAGATGCTGCTGCCCAACCAGTGCAGCTTCTGTGCACACCAGCGGATCCATGCACACAAGTCCCCCTACTGCTGCCCGGAG

TGCGGTGTCCTCTGTCGCTCTGCTTACTTCCAGACTCACGTAAAGGAGAATTGCCTGCACTATGCCCGAAAAGTGGGCTACAG GTGCATTCACTGTGGT

GTCATCCACCTGACTTTGGCCTTGCTGAAAAGCCACATCCAGGAGCGACACTGCCAGGTCTTCCACAAATGTGCATTCTGCCCCATGGCCTTCAAGACTG

CCAGTAGTACGATGGACCACAGTACCACCCAGCACCCCACCCAGCCCCACAAACCCTCCCA GCTAATTTATAAGTGCTCCTGTGAAATGGTCTTCAATA

AGAAGAGGCACATTCAACAACATTTTTACCAGAATGTCAGCAAGACACAGGCGGGTGTTTTCAAGTGCCCTGAGTGCCCACTGCTGTTTCTGCAGAAACC

AGAGTTAATGCAGCATGTCAAG AATACCCATGGTGTTCCCCGGAACGTGGAGGAGCTGTCAAGCCTCCAGTCTTCAACAGACACATCTTCTAACCGCCC

TGGCTCTCGAGCTCCTGCCGAGCCCCCAGCTACAAATGTAGCCGCTAGAGGCAGCTCCCTGACTGCTGGCCGTTGGGGCCGGCCAGAAGCTCACCGCAGG

GCTGAAGCAAGGCCCCGGATGAGGAGCACTGGTTGGACCTGTCAGGAGTGCCAAGAGTGGGTTCCTGATCGAGAGAGCTACGTGTCTCACATGAAAAAGA

GCCACGGTCGG ACGCTGAAGCGGTACCCATGCCGGCAGTGTGAACAGTCCTTTCACAACCCTAGCAGCCTGCGCAAACACATTCGCAACAACCATGACA

CAGTAAAGAAGGTCTACACTTGTGG GTACTGCACCGAGGATAGCCCCAGCTTTCCTCGGCCCTCCCTCCTGGAGAGCCACATTAGCCTTATGCACGGTA

TCAGAAACCCTGATTTGAGCCAGACGTCCAAAGTCAGACATCCAGGTGGACCTTCCCCTCAG GTGAACCATCTGAAAAGACCTGTCAGCAGAATGGCAG

ACGCTCCAGGCACTAGCAATGGTGCGACTGTTTCCTCCACCAAAAGGCACAAGTCCCTGTTTCAGTGTGCAAAGTGCACCTTCGCCACAGACTCGGAACT

TGAGTTCCAGAGCCACATACCTCAGCACCAGGTGGACAGCTCCACAGCCCAGTGTCTTCTCTGTGGCTTGTGCTACACATCTACCAGCTCCCTCAACCGC

CACCTGTTCATAGTCCACAAAGTGAGAGACCAGGAAGAGGGGGGAGAAGACATTGTGGAGGTGAAGGTGGAAGCCCCAGACTCCGAGGCATGCTCTGGAG

AGGAGGTAGCCATGGAGACGAAAGAGAATGGACTGGAAGAATGTGCCAGTGAGCCTTTGGTTACTGACCTAGGAGGTCAGCAAGGTCTGGCTCTGGATGA

AGACAGTGCCCAAGACCCTCAGAATCAACCACAGGCCTCTCAGGACCAGAACAGCCATGCACTATCTCCTCAGGTGTGACCAGAGGCTTTGTAGCCATCA

GTCGGGCTGTGGTACCCTCCAGCTGCTGTGCAGACCGTGGGAAATAAAGAGCTCTGTCGCAGTGTTTGTGTGGCCACTGTGCTCTGGAGCAGTGTCTATT

CTGAGCTGTGGGTTCTGGATATCTCCCAGCCCCCCAAAATGTGGGGTCACCCAGAATTCTTCACAGCTCTGAATTTGCTTCTGTTATTTATGGCTTAATG

CTGCTTATTGATACCCCAATTCTCATCCATGTCCTTCCAGCCCCAGGCTACTTAGGTAGTACAGCCCCAGTGCTGTGTGTCAGCTCAGTGTGCAACCCCT

CAGTAGCTGTGCTCTGGGCTTCCTACCTGCAGTGTTCATCGGGAGACACCGCAGAGTTCTCCTTCCTGCCTTCAGAGCCCAAGAAGGAGGGAAATGAAGG

GTGCTGGCCATTCCTCTGGGAACTCTGCCCAGCTTGGCTTGGTGAGGTCCCTTGTTCACCCTTTCCTTCCTGTCTTCTTTCTCTGATTCTTTTTCCCAGA

ATCATCCTGAGGACTTCACCTGTCACTCTGATCATGTCTCTGTGGGTGGGAAAAATGGCAGTACACTCCTGTTTCGACCTGAGAGAAGCACGAAGTATGG

CCAAGGCAGGCAGGTGCCAAGAGCCAGATCCTCTTTGGGGCTGTGGTGGGTTTTCCTTCTGCTGCTGTCCTGCAATCCCTGACAGGTGGGGTGTGTGGCA

CACAGATATTGGGGTATTTGTATTTTTGTTCCTGTGCCATTAGAGCTGCTGCTGCCTCAGGAAGGCCAGCTCCTCCTCTCGGCTACACTCTTGTTGCTCA

GACTATATTTC
Translation
 - UNI27510 -  - UNI3019 - - UNI16019 - - UNI30237 - MCIDENVSLSHSGSAPDVPAVSVIVKNTSRQESFEAEKDHIAPSLLH

NGFRGSDLPPDSHHCGKFDSTFINGDSARSFTSKLEPSKSEPLPTFNQFSPISSPEPEDPVKDNGFGIKSKHSDSYFPPPPGTVGGPVLEALSKFPVPEL

HMFDHFCKKEPKPEPLPLESQQEHEQGGQKVVEPHKDLDSSRFFGEALEFNSHPSNSIGEPKKLAPELSACSSVPPRQRLKPAHSKLSSCVAALVALQAK

RVANVTKEDQPGHTKDSSGPTKEGSKGSPKMPKSPKSPRSPLEATRKSIKPSDSPRSICSDSSSKGSPSVAASSPPAIPKVRIKTIKTSSGEIKRTVTRI

LPDPDDPSKSPAESPAGSTITEAPSEAPGDEGTAMPVEEHFSEAGIHSGSPQGDRKGDENMIKTSDSSSPCRISGSRVPKGSALNSQASKKQQSTAPQAS

TPAASLLPKAVHLANLNLVPHSVAASVTAKSSAQRRSQPQVTQMTVPLVHQVKKAAPLIVEVFNKVLHSSNPVPLYAPNLSPPADSRIHVPASGYCCLEC

GDAFALEKSLSQHYSRRSVHIEVLCTLCSKTLLFFNKCSLLRHARDHKSKGLVMQCSQLLVKPISADQMFVAAPVNSTAPATPAASSSPKPSPTLDNASS

VIPALPLYPDPVRLIRYGTKCPECHKQMRDYMVLATHFQRTTEETEGL - UNI16019 - - UNI16444 - TCQVCQMLLPNQCSFCAHQRIHAHK

SPYCCPECGVLCRSAYFQTHVKENCLHYARKVGYR RCIHCGVIHLTLALLKSHIQERHCQVFHKCAFCPMAFKTASSTMDHSTTQHPTQPHKPSQ QLI

YKCSCEMVFNKKRHIQQHFYQNVSKTQAGVFKCPECPLLFLQKPELMQHVK NTHGVPRNVEELSSLQSSTDTSSNRPGSRAPAEPPATNVAARGSSLTA

GRWGRPEAHRRAEARPRMRSTGWTCQECQEWVPDRESYVSHMKKSHGR TLKRYPCRQCEQSFHNPSSLRKHIRNNHDTVKKVYTCG GYCTEDSPSFPR

PSLLESHISLMHGIRNPDLSQTSKVRHPGGPSPQ VNHLKRPVSRMADAPGTSNGATVSSTKRHKSLFQCAKCTFATDSELEFQSHIPQHQVDSSTAQCL

LCGLCYTSTSSLNRHLFIVHKVRDQEEGGEDIVEVKVEAPDSEACSGEEVAMETKENGLEECASEPLVTDLGGQQGLALDEDSAQDPQNQPQASQDQNSH

ALSPQV
Transcript ENSMUST00000107353
Sequence
CGCGCGGCCGAGCCCGGGGCCTGTCGCTGCCGCCGCCGCCGCCGCCGCCAG - UNI27510 - GTGGTGACTGGACTCTAGACCATGTGCCTAGGTAG

TTTTTCCCTTCTCCGCAGCTCTGCTTCCCCAGCAACGCTCACCACACCCTTGTTTTGAGAACCTCACTAAG - UNI3019 - - UNI16019 - - U

NI30237 - TACTTGTCAGCATCCAGCCATGGGGGATATGAAAACTCCAGATTTTGATGATCTCCTGGCTGCCTTTGACATCCCAGATCCCACAAGTCT

TGATGCAAAGGAGGCCATCCAGGCTCCCAGTGAGGAGAATGAGAGTCCCCTGAAGTCTTCAGGCATGTGTATCGATGAGAATGTGTCCTTGTCGCACTCA

GGATCAGCCCCAGATGTGCCAGCCGTGAGTGTCATTGTCAAGAACACCAGCCGCCAAGAGTCGTTTGAAGCAGAGAAAGACCACATTGCTCCCAGTCTCC

TACATAATGGATTCCGGGGCTCAGACCTGCCCCCAGACTCCCACCACTGTGGGAAGTTTGATTCTACTTTTATAAATGGAGACAGTGCTAGGAGTTTCAC

AAGCAAGCTAGAGCCTTCCAAGTCGGAGCCATTACCCACCTTCAACCAGTTCAGCCCAATCTCTAGCCCAGAGCCTGAGGATCCTGTCAAAGATAATGGG

TTTGGGATAAAGTCCAAGCACTCTGACAGTTATTTCCCACCTCCTCCTGGGACTGTGGGAGGCCCAGTCCTGGAAGCTCTGTCAAAATTCCCAGTCCCGG

AACTACACATGTTTGATCACTTTTGTAAGAAAGAACCTAAACCAGAACCCTTGCCTTTAGAGAGCCAGCAGGAGCATGAGCAGGGTGGGCAGAAGGTGGT

GGAGCCTCACAAAGATCTGGATTCCAGTCGGTTCTTTGGGGAAGCTTTAGAGTTCAATAGTCACCCTAGCAACAGTATTGGAGAGCCCAAGAAGCTTGCT

CCAGAGCTTAGTGCTTGCTCCTCTGTCCCTCCTAGGCAGCGTCTGAAGCCAGCCCATTCCAAGTTATCCTCTTGTGTTGCAGCCTTGGTGGCCTTACAGG

CCAAAAGGGTGGCCAATGTCACCAAAGAGGATCAGCCTGGTCACACAAAGGATTCCTCAGGGCCCACTAAAGAGGGTTCTAAAGGCAGCCCCAAAATGCC

CAAGTCACCAAAGAGTCCCCGGAGCCCTCTAGAGGCCACTAGAAAAAGTATCAAGCCATCTGATAGCCCTCGGAGCATCTGCAGTGACAGCAGCAGCAAA

GGGTCTCCTTCTGTGGCTGCCAGCTCCCCACCAGCAATTCCCAAAGTCAGAATCAAAACAATTAAGACATCATCGGGGGAAATCAAACGGACGGTTACCA

GGATCCTGCCAGACCCTGATGATCCAAGCAAGTCCCCTGCTGAGTCCCCTGCAGGGAGCACAATCACTGAGGCTCCAAGTGAGGCACCAGGGGATGAAGG

CACAGCCATGCCTGTGGAAGAGCACTTTTCTGAGGCAGGCATACATTCAGGGAGCCCCCAGGGTGACAGAAAAGGGGATGAGAATATGATCAAAACCAGT

GACTCTTCATCTCCCTGCCGCATCTCTGGGTCCAGGGTCCCAAAAGGATCTGCCCTGAACTCACAGGCAAGCAAGAAGCAACAGAGCACAGCACCTCAGG

CATCAACCCCCGCTGCCAGTCTCTTGCCCAAAGCTGTGCACTTGGCCAACTTGAACTTGGTCCCCCACAGTGTTGCCGCATCTGTGACTGCCAAGTCCTC

AGCACAGAGACGGAGCCAGCCTCAGGTCACGCAAATGACAGTGCCCCTGGTCCACCAGGTGAAAAAGGCCGCCCCTCTAATTGTGGAGGTCTTCAACAAG

GTCCTTCACAGCTCTAACCCTGTGCCCCTCTATGCGCCAAATCTCAGCCCACCTGCAGACAGCAGAATCCACGTGCCGGCCAGTGGGTACTGCTGCCTGG

AGTGCGGAGACGCGTTTGCCTTAGAGAAGAGCCTGAGCCAGCACTATAGCCGGCGCAGTGTCCACATTGAGGTGCTGTGCACACTGTGCTCTAAGACACT

GCTCTTCTTCAACAAGTGCAGTCTGCTTCGGCATGCCCGTGACCACAAGAGCAAGGGACTTGTCATGCAGTGCTCTCAGCTGCTTGTGAAGCCCATCTCT

GCGGACCAGATGTTTGTGGCGGCTCCCGTGAACTCCACTGCACCAGCAACCCCAGCCGCTTCTTCCTCCCCCAAACCCAGCCCCACTTTGGACAATGCCA

GCTCTGTAATTCCAGCCTTGCCACTTTATCCAGACCCAGTGAGGCTCATCCGGTATGGAACCAAATGTCCTGAGTGTCACAAGCAGATGCGAGATTATAT

GGTCCTGGCTACACATTTCCAGAGGACAACAGAGGAAACCGAGGGGCTA - UNI16019 - - UNI16444 - ACTTGTCAGGTATGCCAGATGCTG

CTGCCCAACCAGTGCAGCTTCTGTGCACACCAGCGGATCCATGCACACAAGTCCCCCTACTGCTGCCCGGAGTGCGGTGTCCTCTGTCGCTCTGCTTACT

TCCAGACTCACGTAAAGGAGAATTGCCTGCACTATGCCCGAAAAGTGGGCTACAG GTGCATTCACTGTGGTGTCATCCACCTGACTTTGGCCTTGCTGA

AAAGCCACATCCAGGAGCGACACTGCCAGGTCTTCCACAAATGTGCATTCTGCCCCATGGCCTTCAAGACTGCCAGTAGTACGATGGACCACAGTACCAC

CCAGCACCCCACCCAGCCCCACAAACCCTCCCA GCTAATTTATAAGTGCTCCTGTGAAATGGTCTTCAATAAGAAGAGGCACATTCAACAACATTTTTA

CCAGAATGTCAGCAAGACACAGGCGGGTGTTTTCAAGTGCCCTGAGTGCCCACTGCTGTTTCTGCAGAAACCAGAGTTAATGCAGCATGTCAAG AATAC

CCATGGTGTTCCCCGGAACGTGGAGGAGCTGTCAAGCCTCCAGTCTTCAACAGACACATCTTCTAACCGCCCTGGCTCTCGAGCTCCTGCCGAGCCCCCA

GCTACAAATGTAGCCGCTAGAGGCAGCTCCCTGACTGCTGGCCGTTGGGGCCGGCCAGAAGCTCACCGCAGGGCTGAAGCAAGGCCCCGGATGAGGAGCA

CTGGTTGGACCTGTCAGGAGTGCCAAGAGTGGGTTCCTGATCGAGAGAGCTACGTGTCTCACATGAAAAAGAGCCACGGTCGG ACGCTGAAGCGGTACC

CATGCCGGCAGTGTGAACAGTCCTTTCACAACCCTAGCAGCCTGCGCAAACACATTCGCAACAACCATGACACAGTAAAGAAGGTCTACACTTGTGG GT

ACTGCACCGAGGATAGCCCCAGCTTTCCTCGGCCCTCCCTCCTGGAGAGCCACATTAGCCTTATGCACGGTATCAGAAACCCTGATTTGAGCCAGACGTC

CAAAGTCAGACATCCAGGTGGACCTTCCCCTCAG GTGAACCATCTGAAAAGACCTGTCAGCAGAATGGCAGACGCTCCAGGCACTAGCAATGGTGCGAC

TGTTTCCTCCACCAAAAGGCACAAGTCCCTGTTTCAGTGTGCAAAGTGCACCTTCGCCACAGACTCGGAACTTGAGTTCCAGAGCCACATACCTCAGCAC

CAGGTGGACAGCTCCACAGCCCAGTGTCTTCTCTGTGGCTTGTGCTACACATCTACCAGCTCCCTCAACCGCCACCTGTTCATAGTCCACAAAGTGAGAG

ACCAGGAAGAGGGGGGAGAAGACATTGTGGAGGTGAAGGTGGAAGCCCCAGACTCCGAGGCATGCTCTGGAGAGGAGGTAGCCATGGAGACGAAAGAGAA

TGGACTGGAAGAATGTGCCAGTGAGCCTTTGGTTACTGACCTAGGAGGTCAGCAAGGTCTGGCTCTGGATGAAGACAGTGCCCAAGACCCTCAGAATCAA

CCACAGGCCTCTCAGGACCAGAACAGCCATGCACTATCTCCTCAGGTGTGACCAGAGGCTTTGTAGCCATCAGTCGGGCTGTGGTACCCTCCAGCTGCTG

TGCAGACCGTGGGAAATAAAGAGCTCTGTCGCAGTGTTTGTGTGGCCACTGTGCTCTGGAGCAGTGTCTATTCTGAGCTGTGGGTTCTGGATATCTCCCA

GCCCCCCAAAATGTGGGGTCACCCAGAATTCTTCACAGCTCTGAATTTGCTTCTGTTATTTATGGCTTAATGCTGCTTATTGATACCCCAATTCTCATCC

ATGTCCTTCCAGCCCCAGGCTACTTAGGTAGTACAGCCCCAGTGCTGTGTGTCAGCTCAGTGTGCAACCCCTCAGTAGCTGTGCTCTGGGCTTCCTACCT

GCAGTGTTCATCGGGAGACACCGCAGAGTTCTCCTTCCTGCCTTCAGAGCCCAAGAAGGAGGGAAATGAAGGGTGCTGGCCATTCCTCTGGGAACTCTGC

CCAGCTTGGCTTGGTGAGGTCCCTTGTTCACCCTTTCCTTCCTGTCTTCTTTCTCTGATTCTTTTTCCCAGAATCATCCTGAGGACTTCACCTGTCACTC

TGATCATGTCTCTGTGGGTGGGAAAAATGGCAGTACACTCCTGTTTCGACCTGAGAGAAGCACGAAGTATGGCCAAGGCAGGCAGGTGCCAAGAGCCAGA

TCCTCTTTGGGGCTGTGGTGGGTTTTCCTTCTGCTGCTGTCCTGCAATCCCTGACAGGTGGGGTGTGTGGCACACAGATATTGGGGTATTTGTATTTTTG

TTCCTGTGCCATTAGAGCTGCTGCTGCCTCAGGAAGGCCAGCTCCTCCTCTCGGCTACACTCTTGTTGCTCAGACTATATTTCAATAAAAAAAAATCTTA

CCATGCAGGTAGGCTCTTGTATTCCTCTTCTGGTGAGCTAGCCCTTCCCTGCTCCACCTGAGACTCTTCCCAGACAGCCCTGACTGCCCCATCTGAAGCA

AAACAGCATTTCCTGCTGCCCACGGGAGCTCTAGGTTCTGGGGCTTGTGCTTGGGAAAGCAGGAGTCCTATACATCTTGGTTCTCTGGAGAGTTCTAAAG

GAGCAGGGTGGTGTGGTGGGGTGTCAGTACTGGTCAAGAGCCACCTCCAAGGACTGGCCTGGCAGCATTAGCCTTAAGGTCTATTGATATTCTCTGGACA

TCTTTCCATCGAAGGGTTTTCAACCCAAGAGATTCTTGGTGAGGAACGAGGAGAAGGAATTCTGTGACATTCATACAACATTCAGAGACTGCTATTGCCA

CAGCAAATCCAGACTTGGTAGAAATGGGATTAGATGAGACTGGGACAAGTTGTGGGAAGGTGTTCTTGGACCCAACAGGCTCGGGCTAGGTCCTGTAGCA

CAGGGAAGGGGTGCTGGCTGAGTTCCTAGGCTTGATCTTTCAAGGGAGGCATGAATACCAATTAGGAATCAAGTTGGATAAATATGCATGACCTTTTCAC

AACTGAAGACTTTTTTTTTCCTTGCTCTATCAAATGCCAAATTTTTAGTGAAAAGCTAGTGGCAGTGGGAAAAGTTAGTGCTTGCCTCGGTTCCAGAGAG

GCTCTGCTGTACACACCATTTTAATGAGCATTCTTTCTGGCAAGGCCTCCACTTCTCTGCTTCCCCAGCTGACAGTGAAGGGAAGCAAGCCCTACTGAGC

GGGTCCCAAGCCAGCCACTGCCCCTTTCCCAGTTCCTTCACATACCCTGCTTTCTCTTCAGATCCCGTCAGTCCTTCACCTCATGCTAATCTCCCCCATG

TGGGAGATTACCCAACATTGTACCCCAGATCGTTCATGAGAGCAGGTTCTTAAGGAGGGCTTTGAGCTGTATGGCTGCATTTCTTCCCACTCAGAAACCA

TGGGAGCTGGAGAACAAAGAAGGTGGAGAAACTAAGGGTGGAGCCACTGTCCTCATATCAGATCCAGCCTCTTGGAATAGTAGAATAGGACCTGCTGTGG

GAAACCTGTGCTGCCCTCAGCCAGTCCCTAGCACCCTCATCCTCATGGGCTCCTCTCTCAGCAGAGGTAGGAATCCTCATCCAGCTACTTCAAGACTTTC

CTGAGGTCATGAGTGCGCAAGCGCTCTAGGTTCCAGGCTACCATGTGGCTAGGGGCTTCTGCACTTGTAGACACAGTGAGGTGGAGCTCATCTCACTGGA

TGTGGGGTTCAGTTAGGAACGGGGCCCGTTTGCTTATCCATTATGCAGTGATGATGAAGATCGCATTCCCAGCCCTCCTCAGGTCCAGCATCTTGTTTAA

CTCTTACCAGAGACTTTCACTTCATCATCACAAGGATCTCAGCTACCCTTCTATTTTACAGAGGCAAAAAACCAGCCTTAGGTTAAATGACAGACATATT

GGGCTACCTGTGATGACGGTGCTGAGTCAAACCTGTGCTGCCTTAGTGACAGGGCTGCTCTGGCTGCAGCCAGCCTGTCAGCAGTGTGGAGCCATCCAAA

GCCCACCCTTCTAGTTCCCAAAAAAGGCAGGGTGCCCCTTAATGTCAGATCCTCCAGTGCCTTGTCACCCCAAGGAGGGCCCTGCGTTTGCACATGCGGT

GTCCCTGATGTCGTCTCTCACTGGGGTTTACTTTCCATATGAAGAGCCATCATTTCTGGAGCACTCTTTAGAAGAGGTTACCTAATGTCTGGGGAACACA

CGGTTCCCTTCGAGTCAGTATCTCCTGATTGCTCAGGACAGTGTTTTAGTACACTGTCGGTCATCCGAGGATGCTTGCTGTAACAGATACTTCCCCTGCA

GCGGATGCTCTCCTGACCAAGCTAGCTTAGATCTGCTACCCTCTAGAAGCTACCCATCTGGATACCCTGAGGCTTGACAAATGACTAGTATTTACTCTCT

AACTGCTTTGTCTCTGTAAAATGATATGCTGAATTTCCGTGGACTAATTGTTGTAAAGAATTTGCCTCTTATGTAAACAGTCTGGGTTTTAAAAATTTAA

TGGTTGTGTTGTGGCCCACCTTAGAATTCCCACATTTTGCCTTGCCCTAGGCTGAGGAACTTCTGTCCTGTATACCATTGTACATTCAACACCAGGTAAT

TTAAAAAACTTTTTTTGGGGGGGTTTGGAAAAATAGATACATATACATTTGACAACATAAGGCATTCAACAGTACAAATGAACATACAATAAAAAGTAAA

GTTCTTGGTGGAGGTCAGCTTCCAGTGCCCTTGCCAGAGTTCCTCATTGTTATCTCTACCTTGTGTATCCTTTCAGAGCAATTCTATGCATTTATGAGTT

TATAAATATGTATATTTATATATCTATTTTTAATACAAACAGTAGCATTCTA
Translation
 - UNI27510 -  - UNI3019 - - UNI16019 - - UNI30237 - MGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQAPSEENESPLKSSGMC

IDENVSLSHSGSAPDVPAVSVIVKNTSRQESFEAEKDHIAPSLLHNGFRGSDLPPDSHHCGKFDSTFINGDSARSFTSKLEPSKSEPLPTFNQFSPISSP

EPEDPVKDNGFGIKSKHSDSYFPPPPGTVGGPVLEALSKFPVPELHMFDHFCKKEPKPEPLPLESQQEHEQGGQKVVEPHKDLDSSRFFGEALEFNSHPS

NSIGEPKKLAPELSACSSVPPRQRLKPAHSKLSSCVAALVALQAKRVANVTKEDQPGHTKDSSGPTKEGSKGSPKMPKSPKSPRSPLEATRKSIKPSDSP

RSICSDSSSKGSPSVAASSPPAIPKVRIKTIKTSSGEIKRTVTRILPDPDDPSKSPAESPAGSTITEAPSEAPGDEGTAMPVEEHFSEAGIHSGSPQGDR

KGDENMIKTSDSSSPCRISGSRVPKGSALNSQASKKQQSTAPQASTPAASLLPKAVHLANLNLVPHSVAASVTAKSSAQRRSQPQVTQMTVPLVHQVKKA

APLIVEVFNKVLHSSNPVPLYAPNLSPPADSRIHVPASGYCCLECGDAFALEKSLSQHYSRRSVHIEVLCTLCSKTLLFFNKCSLLRHARDHKSKGLVMQ

CSQLLVKPISADQMFVAAPVNSTAPATPAASSSPKPSPTLDNASSVIPALPLYPDPVRLIRYGTKCPECHKQMRDYMVLATHFQRTTEETEGL - UNI1

6019 - - UNI16444 - TCQVCQMLLPNQCSFCAHQRIHAHKSPYCCPECGVLCRSAYFQTHVKENCLHYARKVGYR RCIHCGVIHLTLALLKSHI

QERHCQVFHKCAFCPMAFKTASSTMDHSTTQHPTQPHKPSQ QLIYKCSCEMVFNKKRHIQQHFYQNVSKTQAGVFKCPECPLLFLQKPELMQHVK NTH

GVPRNVEELSSLQSSTDTSSNRPGSRAPAEPPATNVAARGSSLTAGRWGRPEAHRRAEARPRMRSTGWTCQECQEWVPDRESYVSHMKKSHGR TLKRYP

CRQCEQSFHNPSSLRKHIRNNHDTVKKVYTCG GYCTEDSPSFPRPSLLESHISLMHGIRNPDLSQTSKVRHPGGPSPQ VNHLKRPVSRMADAPGTSNG

ATVSSTKRHKSLFQCAKCTFATDSELEFQSHIPQHQVDSSTAQCLLCGLCYTSTSSLNRHLFIVHKVRDQEEGGEDIVEVKVEAPDSEACSGEEVAMETK

ENGLEECASEPLVTDLGGQQGLALDEDSAQDPQNQPQASQDQNSHALSPQV

For any suggestions or comments, please send an email to unitrap@crg.es