Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000005667 (Mthfd2)
Chromosomal location
Chr 6: 83255700 - 83267581 (-)
Description
methylenetetrahydrofolate dehydrogenase (NAD+ dependent), methenyltetrahydrofolate cyclohydrolase Gene [Source:MGI (curated);Acc:Mthfd2-001]
RefSeq_dna
NM_008638 
RefSeq_peptide
NP_032664.1 
UniGene
Mm.443 
MGI
MGI:1338850 
Uniprot/SWISSPROT
P18155 
Uniprot/SPTREMBL
Q3U8E7 
Human Ortholog
ENSG00000065911 (MTHFD2)
Omim not available
UniTrap UNI27866
Vector Insertion
Chr 6: 83263541 - 83267422
Public Clones D085H04 (ggtc)
Private Clones OST45501 (lexicon) OST32929 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16782
Vector Insertion
Chr 6: 83261357 - 83261805
Public Clones not available
Private Clones OST454136 (lexicon)
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000005810
Sequence
GGTATAGCTTCGTGGCCCGCGCGCGCGCTTCTCTCCGGCGCGGGCACCGGCGCGAGCCATGGCTTCAGTTTCCTTGTTGTCTGCGTTGGCTGTGCGGTTG

TTGCGCCCCACGCACGGCTGCCACCCCCGCCTACAGCCCTTCCACCTGGCGGCAGTGCG - UNI27866 - AAATGAAGCCGTTGTCATTTCTGGAAG

GAAACTGGCCCAGCAGATCAAGCAAGAAGTACAGCAGGAGGTGGAAGAGTGGGTGGCCTCAGGCAACAAGCGGCCACACCTCAGTGTCATTCTGGTTGGT

GACAATCCCGCCAGTCACTCCTATGTTCTCAACAAAACCAGGGCAGCAGCTGAAGTGG GAATCAACAGTGAGACAATTGTGAAACCAGCCTCAGTTTCA

GAGGAAGAGCTGCTGAATTCAATCAGGAAGCTGAACAACGATGAGAACGTAGATGGCCTCCTTGTTCAGCTGCCACTCCCAG - UNI16782 - AGCA

CATTGATGAGAGGAAGGTCTGCAATGCCGTTTCTCCTGACAAGGATGTTGATGGCTTTCATGTCATTAACGTGGGGCGAATGTGCTTGGACCAGTACTCT

ATGCTGCCAGCAACCCCATGGGGCGTGTGGGAGATAATTAAGCGAACAG GCATTCCAACCTTAGGGAAGAATGTGGTAGTGGCTGGCAGGTCAAAAAAC

GTTGGAATGCCGATTGCAATGTTGCTGCACACAGATGGAGCTCACGAACGGCCCGGGG GTGATGCCACAGTCACAATATCTCATCGATACACTCCCAAA

GAGCAGCTGAAGAAGCACACGATCCTTGCAGACATTGTAATATCTGCCGCTG GCATTCCAAATCTGATCACAGCTGACATGATCAAGGAAGGAGCAGCG

GTCATCGATGTGGGAATAAACAGAGTTCAAGATCCTGTCACTGCAAAGCCCAAATTGGTTGGAGATGTGGATTTTGAAG GAGTCAAGAAGAAAGCTGGT

TATATCACTCCCGTCCCTGGTGGTGTGGGTCCCATGACCGTGGCCATGCTCATGAAGAACACCATTATTGCCGCAAAGAAAGTGCTAAGACCAGAGGAGC

TGGAAGTGTTCAAGTCCAAACAGCGCGGAGTCGCCACCAACTAGCAGCACTCTGAGCCAGCCCGAGAGGCTAAGCAGGCCAAGAGGAATGCAGTGTTTTT

AATTTATTCTGTCGAAATGGTTTAAAATGTTTGTATTTATTGAAAGCTTAAACGGGTGGCTGTGTGCGCGCATGGCTCTACAGAACCTCACCAGGATGCC

CATCAGTTGTCCTGCCTTTGACCTGGTGATGCACAGGAGACGTCCTCACACCGAGAGTGGATGCTGAACTTCATCAAAAAAAAAAAAAGGTCTGCCGTTT

TAGGCTCTCATTTCCCAAGTGCTATTCCAATACAAGTTGATGACTCATCTTAGGTCCCAAGCCTTTGAGTTCAACTTTCAAACCAAAGGAAACCTTAGTA

GAGGAAATGAAGGGAAAGGAAGAGAAAGCAGCACAGGGTTTCAACGGCACTCCCTTACTCTCTCGGGAGTGCAGCCAGGAGTGCTCCGATTGCCCTGAGG

AGAGCTCAGCTGGCTGGGCCTAGCTGTCCCCCTGTGGCGGGTCGTCAGGGAAGGGTTAGAGTCTCCCCACTTGCTGTTATCCTCCTGTGAGCTTGTCCTA

TCTATTTTAATTTTCTAGAATCGAAAAAGCTCATTTTATAAATGATGTGTGTATTATCACGTTTGGCTTTTGCAGCACATTTAAACTTTTAAGTTTCAGA

CTGTTAAGAGAGTTGTGTGTCTGTTTTCTTTGGCGGGTGCTTTGAGGCCTATTTGTTTTTGAAAAACAAAACAAAACTTGTGCGTGATAATCACGAGGGC

AGCTCGTGCCACCAAAGAACTGTCAGCAGCTGCCTGCACGTCTTTCACGTACCCCGTTGGCTTTCCTGTAAGCTATCCAGGAGCTTGGGTTAATATAAGA

CTTAGTCGGATTTTCTTATTAAAGGGTTTTCTTGCAGTTGGGTTTTTTGTTTGTTTTTAAATAAAGCTCATCTGTCGGGTGTGG
Translation
MASVSLLSALAVRLLRPTHGCHPRLQPFHLAAVR - UNI27866 - RNEAVVISGRKLAQQIKQEVQQEVEEWVASGNKRPHLSVILVGDNPASHSYV

LNKTRAAAEVG GINSETIVKPASVSEEELLNSIRKLNNDENVDGLLVQLPLPE - UNI16782 - EHIDERKVCNAVSPDKDVDGFHVINVGRMCLD

QYSMLPATPWGVWEIIKRTG GIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGG GDATVTISHRYTPKEQLKKHTILADIVISAAG GIPNLITA

DMIKEGAAVIDVGINRVQDPVTAKPKLVGDVDFEG GVKKKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVLRPEELEVFKSKQRGVATN

For any suggestions or comments, please send an email to unitrap@crg.es