Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000005681 (Apoa2)
Chromosomal location
Chr 1: 173155185 - 173156510 (+)
Description
apolipoprotein A-II Gene [Source:MGI (curated);Acc:Apoa2-002]
RefSeq_dna
NM_013474 
RefSeq_peptide
NP_038502.2 
MGI
MGI:88050 
Uniprot/SWISSPROT
P09813 
Uniprot/SPTREMBL
A7YL62 Q3UKX6 Q6LD55 
Human Ortholog
ENSG00000158874 (APOA2)
Omim not available
UniTrap UNI28488
Vector Insertion
Chr 1: 173156273 - 173156469
Public Clones not available
Private Clones OST29841 (lexicon) OST28645 (lexicon)
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000005824
Sequence
GTAGACGGGAAGGACTGCAGCACAGAATCG CAGCACTGTTCCTAGGCCATAGTCTGCCATCATGAAGCTGCTCGCAATGGTCGCACTGCTGGTCACCAT

CTGTAGCCTGGAAG GAGCTTTGGTTAAGAGACAGGCAGACGGACCGGATATGCAGAGCCTGTTCACTCAATACTTTCAGAGCATGACTGATTATGGCAA

AGATTTGATGGAGAAGGCCAAGACCTCAGAGATTCAGAGCCAGGCCAA - UNI28488 - GGCATACTTTGAGAAGACACACGAGCAGCTGACACCCC

TTGTCAGGTCAGCAGGAACTAGTCTGGTGAACTTCTTCAGCAGTTTAATGAACCTTGAGGAGAAACCGGCTCCTGCGGCTAAGTGAGATGTGCCAGGCCC

AGTCTTCCCACCCCAGCTGCTCCACTGGCCACCGCTAGAGCCCCTCTCCCTACCTTCTGCCTGTTTTCTCCAATAAATGCGGAAGGAGTTAAACT
Translation
 MKLLAMVALLVTICSLEG GALVKRQADGPDMQSLFTQYFQSMTDYGKDLMEKAKTSEIQSQAK - UNI28488 - KAYFEKTHEQLTPLVRSAGTS

LVNFFSSLMNLEEKPAPAAK
Transcript ENSMUST00000111321
Sequence
ATATGTGTATATAGCCCCTACCTCCAGTCAAGCCCAGAGTAGACGGGAAGGACTGCAGCACAGAATCG CACTGTTCCTAGGCCATAGTCTGCCATCATG

AAGCTGCTCGCAATGGTCGCACTGCTGGTCACCATCTGTAGCCTGGAAG GAGCTTTGGTTAAGAGACAGGCAGACGGACCGGATATGCAGAGCCTGTTC

ACTCAATACTTTCAGAGCATGACTGATTATGGCAAAGATTTGATGGAGAAGGCCAAGACCTCAGAGATTCAGAGCCAGGCCAA - UNI28488 - GGC

ATACTTTGAGAAGACACACGAGCAGCTGACACCCCTTGTCAGGTCAGCAGGAACTAGTCTGGTGAACTTCTTCAGCAGTTTAATGAACCTTGAGGAGAAA

CCGGCTCCTGCGGCTAAGTGAGATGTGCCAGGCCCAGTCTTCCCACCCCAGCTGCTCCACTGGCCACCGCTAGAGCCCCTCTCCCTACCTTCTGCCTGTT

TTCTCCAATAAATGCGGAAGGAGTTAAACTTCAT
Translation
 MKLLAMVALLVTICSLEG GALVKRQADGPDMQSLFTQYFQSMTDYGKDLMEKAKTSEIQSQAK - UNI28488 - KAYFEKTHEQLTPLVRSAGTS

LVNFFSSLMNLEEKPAPAAK
Transcript ENSMUST00000111320
Sequence
AGCCCAGAGTAGACGGGAAGGACTGCAGCACAGAATCG GCCATAGTCTGCCATCATGAAGCTGCTCGCAATGGTCGCACTGCTGGTCACCATCTGTAGC

CTGGAAG GAGCTTTGGTTAAGAGACAGGCAGACGGACCGGATATGCAGAGCCTGTTCACTCAATACTTTCAGAGCATGACTGATTATGGCAAAGATTTG

ATGGAGAAGGCCAAGACCTCAGAGATTCAGAGCCAGGCCAA - UNI28488 - GGCATACTTTGAGAAGACACACGAGCAGCTGACACCCCTTGTCAG

GTCAGCAGGAACTAGTCTGGTGAACTTCTTCAGCAGTTTAATGAACCTTGAGGAGAAACCGGCTCCTGCGGCTAAGTGAGATGTGCCAGGCCCAGTCTTC

CCACCCCAGCTGCTCCACTGGCCACCGCTAGAGCCCCTCTCCCTACCTTCTGCCTGTTTTCTCCAATAAATGCGGAAGGAGTTAAA
Translation
 MKLLAMVALLVTICSLEG GALVKRQADGPDMQSLFTQYFQSMTDYGKDLMEKAKTSEIQSQAK - UNI28488 - KAYFEKTHEQLTPLVRSAGTS

LVNFFSSLMNLEEKPAPAAK
Transcript ENSMUST00000111319
Sequence
AGTAGACGGGAAGGACTGCAGCACAGAATCG TGTTCTTTCTCACCAGCAGCACTGTTCCTAGGCCATAGTCTGCCATCATGAAGCTGCTCGCAATGGTC

GCACTGCTGGTCACCATCTGTAGCCTGGAAG GAGCTTTGGTTAAGAGACAGGCAGACGGACCGGATATGCAGAGCCTGTTCACTCAATACTTTCAGAGC

ATGACTGATTATGGCAAAGATTTGATGGAGAAGGCCAAGACCTCAGAGATTCAGAGCCAGGCCAA - UNI28488 - GGCATACTTTGAGAAGACACA

CGAGCAGCTGACACCCCTTGTCAGGTCAGCAGGAACTAGTCTGGTGAACTTCTTCAGCAGTTTAATGAACCTTGAGGAGAAACCGGCTCCTGCGGCTAAG

TGAGATGTGCCAGGCCCAGTCTTCCCACCCCAGCTGCTCCACTGGCCACCGCTAGAGCCCCTCTCCCTACCTTC
Translation
 MKLLAMVALLVTICSLEG GALVKRQADGPDMQSLFTQYFQSMTDYGKDLMEKAKTSEIQSQAK - UNI28488 - KAYFEKTHEQLTPLVRSAGTS

LVNFFSSLMNLEEKPAPAAK

For any suggestions or comments, please send an email to unitrap@crg.es