Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000005683 (Cs)
Chromosomal location
Chr 10: 127774790 - 127799534 (+)
Description
citrate synthase Gene [Source:MGI Symbol;Acc:MGI:88529]
RefSeq_dna
NM_026444 
RefSeq_peptide
NP_080720.1 
UniGene
Mm.413891 
MGI
MGI:88529 
Uniprot/SWISSPROT
Q9CZU6 
Uniprot/SPTREMBL
Q0QEL9 
Human Ortholog
ENSG00000062485 (CS)
Omim not available
UniTrap UNI4248
Vector Insertion
Chr 10: 127775016 - 127786808
Public Clones AN0926 (sanger) (sanger) AJ0634 (sanger) RRC290 (baygenomics) RRJ140 (baygenomics)
RRK198 (baygenomics) P124B11 (ggtc) PST5711-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1964
Vector Insertion
Chr 10: 127786860 - 127787488
Public Clones AZ0155 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11285
Vector Insertion
Chr 10: 127789862 - 127790078
Public Clones G073H09 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11281
Vector Insertion
Chr 10: 127796356 - 127796489
Public Clones G075A01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000005826
Sequence
GGGGCCTCGCCGAGGACCCTGGGCTGGGCGCCTGTGCCGGTTTGTCTACCCTTCCCCTCAGCCGCCTCCTTTCAACCTTGTCCGCCGGTTGGCGCGGTCT

CCATCACAGCGGCGACCGCTCCTGTTGCAGCTGTAGCTCTCTCCCTTCGGTCCCTTCCCGCCAGGTCCCGGAGTTTCGCCCGCCATGGCTCTACTCACTG

CAGCAACCCGGCTCTTGGGAGCCAAG - UNI4248 - AACTCATCCTGCCTCGTCCTTGCTGCCCGGCATGCCAGTGCTTCTTCCACG - UNI1964

 - AATTTGAAAGATGTACTGAGCAATCTGATACCTAAGGAGCAGGCCAGAATTAAGACCTTCAAGCAGCAACATGGGAAGACAGTGGTGGGCCAGATCA

CTGTGGACATG ATGTACGGTGGCATGAGAGGCATGAAGGGACTTGTGTATGAGACTTCGGTTCTTGATCCTGACGAG GGCATCCGTTTCCGAGGCTAC

AGTATCCCTGAGTGCCAGAAAATGCTGCCTAAGGCTAAGGGTGGAGAAGAACCCCTGCCTGAGGGCTTATTTTGGCTGCTGGTAACTGGACAGATGCCCA

CAGAGGAACAG - UNI11285 - GTGTCTTGGCTCTCACGAGAATGGGCAAAAAGGGCAGCTCTGCCTTCTCATGTGGTCACCATGCTGGACAATTTT

CCAACCAATCTGCACCCTATGTCTCAGCTCAGTGCAGCCATCACAGCCCTCAACAGTGAAAGCAACTTCGCCCGGGCATATGCAGAGGGAATGAACCGAG

CTAAGTACTGGGAG CTCATCTATGAGGACTGCATGGACCTCATTGCCAAGCTGCCGTGCGTTGCAGCCAAGATCTACCGGAATCTGTACCGGGAGGGCA

GCAGTATCGGAGCCATTGACTCTAGGCTAGACTGGTCACACAATTTTACCAACATGTTAGGCTACACCGACCCTCAGTTCACCGAGCTCATGCGTTTGTA

CCTCACCATCCATAG TGACCATGAGGGTGGTAATGTAAGTGCCCACACAAGCCATTTGGTGGGCAGCGCCCTTTCAGACCCTTACCTGTCCTTTGCAGC

AGCCATGAATGGGCTGGCGGGGCCTCTACATGGACTAGCAAATCAG - UNI11281 - GAGGTGCTTGTCTGGCTGACACAGCTACAGAAGGAAGTTG

GCAAAGACGTGTCAGATGAGAAGTTACGAGACTACATCTGGAACACACTCAATTCAGGACGG GTGGTCCCAGGATACGGTCATGCAGTACTGAGGAAGA

CTGACCCTCGCTATTCCTGTCAGCGAGAGTTTGCTCTGAAACATCTGCCTAAGGATCCCATGTTCAAGCTGGTGGCTCAGCTGTACAAGATTGTGCCCAA

TATCCTCTTAGAGCAAGGGAAGGCTAAGAACCCTTGGCCCAACGTAGACGCTCACAGTGGGGTGCTGCTCCAG TACTATGGCATGACGGAGATGAACTA

CTACACAGTCCTGTTTGGAGTGTCTCGGGCACTGGGTGTGCTAGCCCAGCTCATCTGGAGCAGAGCCCTAGGCTTCCCCCTGGAAAGGCCCAAGTCCATG

AGCACGGATGGCCTGATGAAGTTTGTGGACTCTAAGTAAGGGTAAAATGGGAGACTGGGGGGAAACTGACTATAAGAAAACGAGGAAGCTTAAAAATAAA

GTGTAATTTTGTTTTGTTTCAGGGGCCTTTAAGACTTAAGATTAAACTGTATCTGAGGCACTGAAAATATATTTGAAGTTAAAATATAAATTAAGACTTG

AAAGACAAAAGTGACCCCTTCTCCCCTCACCAGTTCACCTCCCCCTCCTGGTATGAGCTGCCCAGCAGCTGTAGGATGACCGGGACTGAAGCATGTGGTC

AGGGTTAGATCTGCCTACCACCATCTCTAGAGCAAGACTCAGGCTCCTCCTCTTTAGGTCAGAGCAGGTTACAGACAAGCTGCAGTCACTCATGGAGCTT

TGTTTCTATGCTGCCACCCCCAAGTCATCTACGCCAGGGACAGGCCCCTTTCTTTCCATAGAAATCATGTTGGATGCCAGCTGTGTCCAACACTAGGGCC

TTTCCCAATGTACACAAACACCTCCTACCTAGCAAGATCTCTTGGTTAGCTGGAGACGCTTTGGCAACTTTTTATGCTATCAGATGATCTTAAATGGCGT

AGTATTTATTGTGACTGGCACCCAACATTTGAGTTATTTCTCCTTTTAAATTTATACCATTAAAGTTAAGGTCTGGGGAGTTATGTTTCCTTCCAGGCCT

CTATACCTGCTGTGCCTCAAGCTGAGGATGCTGGGGGTCTCCCTGTCCTGAACTCCACTAGGGTCCTCTCTCAGCAGGTCTGTCCGACCTGTGGTCTTCC

TGGTCGTTTGGCTTTATCAGTACTTAATGTGAACTAGGTCTTTTACTTCCATGGAACATAAGCCACTATCTTCTGACCTTGGTTTCTCCTGTTAATATGC

TCTGGCACGGAACAAGGGCTCAGGAATGACCAGCCTCTTCGGGCCTGGTCCCAGGGGTTCTAGCTTTTCTTTTTGAACAGCAGTTACACACAGTTCCCAC

TGAATATCAGATGGATGGACCTAGGGCTTGGGGCCTTCTTCTCATCCCGTGTCAAGGAAACGGTCCTTTATTTATCAGTGTCTTTTGCTCTTCCCTTAAG

TAAGAGCCCATAGCACAGCACTTATTTTAGCAGCCCCATTTGCACAGATTTTCAGTGACTCAGAATGCTCTACTGCCTTTTCTTTGAGAAAGGGTTGAGA

TACACTCCTGTCCTGCCCCTCCTCATCCCAAAGCTCCTGCCTGTGTTTGTATGGAACCCAACTCCAGCACCACCACACTGTTGAGATGGACACACTGTAA

ACCCCTGGGTAACTGTTAAAGTCATGATGCAGACTTCAGGATGTTCTGTATAAAATTAAAAATAATAAATGTTTTTATTAACAAT
Translation
MALLTAATRLLGAK - UNI4248 - NSSCLVLAARHASASST - UNI1964 - NLKDVLSNLIPKEQARIKTFKQQHGKTVVGQITVDM MYGGMR

GMKGLVYETSVLDPDE GIRFRGYSIPECQKMLPKAKGGEEPLPEGLFWLLVTGQMPTEEQ - UNI11285 - VSWLSREWAKRAALPSHVVTMLDNF

PTNLHPMSQLSAAITALNSESNFARAYAEGMNRAKYWE LIYEDCMDLIAKLPCVAAKIYRNLYREGSSIGAIDSRLDWSHNFTNMLGYTDPQFTELMRL

YLTIHS SDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQ - UNI11281 - EVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGR 

VVPGYGHAVLRKTDPRYSCQREFALKHLPKDPMFKLVAQLYKIVPNILLEQGKAKNPWPNVDAHSGVLLQ YYGMTEMNYYTVLFGVSRALGVLAQLIWS

RALGFPLERPKSMSTDGLMKFVDSK

For any suggestions or comments, please send an email to unitrap@crg.es