Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000005698 (Ctcf)
Chromosomal location
Chr 8: 108160479 - 108206821 (+)
Description
CCCTC-binding factor Gene [Source:MGI (curated);Acc:Ctcf-001]
RefSeq_dna
NM_007794 NM_181322 
RefSeq_peptide
NP_851839.1 
UniGene
Mm.269474 Mm.397215 
MGI
MGI:109447 
Uniprot/SWISSPROT
Q61164 
Uniprot/SPTREMBL
Q05CK6 Q3USR8 Q3UYZ8 Q3UZH8 
Human Ortholog
ENSG00000102974 (CTCF)
Omim not available
UniTrap UNI1642
Vector Insertion
Chr 8: 108160621 - 108167415
Public Clones DD0129 (sanger) D075B10 (ggtc) P138D04 (ggtc) P107D12 (ggtc) (ggtc)
P149E03 (ggtc) P116F05 (ggtc) D076F01 (ggtc) D023C08 (ggtc) 5SP126F09 (ggtc)
FHCRC-GT-S1-5D1 (fhcrc) PST24667-NR (escells) IST13248A6 (tigm) IST14969G6 (tigm)
IST11613C6 (tigm) IST14232G7 (tigm) IST14583D12 (tigm) IST14572E10 (tigm)
IST13878D4 (tigm)
Private Clones OST446309 (lexicon) OST446050 (lexicon) OST375246 (lexicon) OST330024 (lexicon)
OST328178 (lexicon) OST327819 (lexicon) OST323815 (lexicon) OST323726 (lexicon)
OST316244 (lexicon) OST297310 (lexicon) OST293175 (lexicon) OST279795 (lexicon)
OST279200 (lexicon) OST259229 (lexicon) OST244685 (lexicon) OST232547 (lexicon)
OST216120 (lexicon) OST212212 (lexicon) OST205193 (lexicon) OST166160 (lexicon)
OST147627 (lexicon) OST147626 (lexicon) OST141461 (lexicon) OST135380 (lexicon)
OST126050 (lexicon) OST123065 (lexicon) OST119063 (lexicon) OST115680 (lexicon)
OST115001 (lexicon) OST92151 (lexicon) OST86095 (lexicon) OST67812 (lexicon)
OST67332 (lexicon) OST65058 (lexicon) OST61839 (lexicon) OST59181 (lexicon)
OST45458 (lexicon) OST45346 (lexicon) OST41742 (lexicon) OST40310 (lexicon)
OST36726 (lexicon) OST35245 (lexicon) OST30371 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1536
Vector Insertion
Chr 8: 108167533 - 108187653
Public Clones CC0281 (sanger) RRG131 (baygenomics) RRG147 (baygenomics) D068F04 (ggtc)
W072F05 (ggtc) CMHD-GT_327E3-3 (cmhd) IST13848F11 (tigm) IST15061D10 (tigm)
IST14617B12 (tigm) IST14479B11 (tigm) IST13848F10 (tigm)
Private Clones OST500656 (lexicon) OST469472 (lexicon) OST428392 (lexicon) OST420966 (lexicon)
OST332387 (lexicon) OST299913 (lexicon) OST278813 (lexicon) OST258291 (lexicon)
OST255077 (lexicon) OST250837 (lexicon) OST236254 (lexicon) OST235413 (lexicon)
OST219138 (lexicon) OST190747 (lexicon) OST184218 (lexicon) OST150792 (lexicon)
OST68967 (lexicon) OST61880 (lexicon) OST54501 (lexicon) OST42341 (lexicon)
OST32268 (lexicon) OST5841 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8017
Vector Insertion
Chr 8: 108190693 - 108194130
Public Clones RRJ017 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33082
Vector Insertion
Chr 8: 108198930 - 108199895
Public Clones IST11257D2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI735
Vector Insertion
Chr 8: 108201251 - 108203970
Public Clones DA0119 (sanger) W084D01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000005841
Sequence
AAACCGTGCGCGGAGCTGCTTCTTTGGCGGCAGCGGCGACCAGCAGCAGCCGGTGCGGGCGCGCGGAGCCGGCCGGGGACGCCAGGTGGCCGGAGCGGTG

GAGCGGCGGCGGAGCGGGCGCCGCGGGGGGTGTGGCGCGAAG - UNI1642 - AATGACCACAAATCTAGAACCAAAGAACACGATGCACTAGCAGAC

AGACTCGAAGCTAGAGACTGGAGATCTGGGTTCTTTTGTCCTTCCTCAAACTGATTTTGCAGCCACGGAGAG - UNI1536 - GAAGGGGAGATGGAA

GGTGAGGCGGTTGAAGCCATTGTGGAGGAGTCTGAAACTTTCATTAAAGGAAAAGAAAGAAAGACTTACCAGAGACGCCGGGAAGGGGGCCAGGAAGAAG

ATGCTTGCCACCTGCCCCAGAACCAGACAGATGGGGGTGAGGTGGTCCAGGATGTCAACAGCAGTGTACAGATGGTAATGATGGAACAGCTGGATCCTAC

CCTTCTCCAGATGAAGACTGAAGTCATGGAGGGTACAGTGGCTCCGGAAGCAGAGGCTGCAGTGGACGATACCCAGATCATAACCTTGCAGGTTGTAAAT

ATGGAGGAACAGCCCATTAACATAGGAGAGCTTCAGCTTGTCCAAGTACCTGTTCCTGTGACGGTACCTGTTGCTACTACTTCAGTAGAAGAACTTCAGG

GGGCTTATGAGAATGAAGTGTCTAAAGAGGGCCTTGCAGAAAGTGAACCGATGATATGTCACACCTTACCTTTGCCTGAAGGATTTCAGGTGGTGAAAGT

GGGGGCCAATGGAGAAGTGGAGACACTAGAGCAGGGCGAGCTTCCTCCTCAGGAAGACTCTAGCTGGCAAAAAGACCCAGACTATCAGCCACCAGCCAAA

AAAACAAAGAAAACCAAAAAGAGCAAACTTCGTTACACAGAAGAGGGCAAAGACGTGGATGTGTCTGTGTATGATTTTGAGGAAGAACAGCAGGAAGGAC

TGCTGTCTGAGGTTAATGCAGAGAAAGTAGTTGGTAATATGAAGCCTCCGAAGCCAACAAAAATTAAAAAAAAAG GTGTAAAGAAAACATTCCAGTGTG

AGCTTTGCAGTTACACATGTCCCCGGCGTTCAAATTTGGATCGTCACATGAAAAGCCACACTGATGAGAGACCACACAAATGCCATCTGTGTGGCAGAGC

ATTCAGAACAGTGACCCTCCTGAGGAATCATCTGAACACACACACAG GTACTCGTCCTCACAAGTGCCCAGACTGCGATATGGCCTTTGTGACCAGTGG

AGAATTGGTGCGGCATCGTCGTTATAAACACACTCATGAGAAACCATTTAAGTGTTCCATGTGTGATTATGCCAGTGTAGAA - UNI8017 - GTCAG

CAAATTAAAACGACACATTCGCTCTCATACTGGAGAGCGCCCGTTCCAGTGCAGTTTGTGCAGTTATGCCAGCAGGGACACATACAAGCTGAAAAGGCAT

ATGAGAACCCATTCAG GGGAAAAACCTTATGAATGTTATATTTGTCACGCTCGGTTTACCCAGAGTGGTACCATGAAGATGCACATTTTACAGAAGCAC

ACAGAAAATGTGGCCAAATTTCATTGTCCCCATTGTGACACTGTCATAGCCCGAAAAAGTGATTTGG GTGTCCACTTGCGAAAGCAGCATTCCTATATT

GAACAGGGCAAAAAATGTCGCTACTGTGATGCTGTGTTTCATGAGCGATATGCTCTCATCCAGCATCAAAAATCACACAAAAATGAGAAGCGCTTCAAGT

GTGACCAGTGTGATTATGCTTGTAGACAG - UNI33082 - GAGCGGCACATGATCATGCACAAGCGCACTCACACGGGGGAGAAGCCTTATGCCTGC

AGCCACTGCGACAAGACCTTCCGCCAGAAACAGCTCCTCGACATGCATTTCAAGCGCTATCATGATCCCAACTTTGTCCCTGCTGCCTTTGTCTGTTCCA

AGTGTGGGAAAACATTCACCCGCCGG AACACAATGGCAAGACATGCAGATAACTGTGCTGGTCCAGATGGCGTAGAGGGGGAAAATGGAGGGGAGACAA

AGAAGAGCAAACGAGGAAGAAAAAGAAAGATGCGATCTAAAAAAGAAGACTCCTCTGACAGTG - UNI735 - AAGAAAATGCTGAGCCGGATCTCGA

TGACAATGAGGAGGAGGAGGAGCCTGCTGTAGAAATTGAACCTGAGCCAGAGCCTCAGCCCCAGCCTCCGCCTCCACCTCAGCCTGTGGCCCCGGCCCCC

CCACCTGCCAAGAAGAGAAGGGGGCGACCTCCTGGAAGAACCAACCAGCCCAAACAGAACCAGC CAACAGCCATCATTCAGGTCGAAGATCAGAATACA

GGTGCAATTGAGAACATTATAGTTGAAGTCAAAAAGGAGCCAGATGCCGAGCCTGCGGAGGGGGAAGAAGAGGAGGCTCAGGCAGCCACCACAGACGCCC

CCAACGGAGACCTCACGCCTGAGATGATCCTCAGCATGATGGACCGGTGATGCTGGGGCCTTGCTCGGCACCAGGACTATTGGGCTGTGTTTAAACGGCC

CAAATCTTAATTTTTCTCTTTTTTTTCTTTGGCTTTGGGAACGGCATAATTTTACACCATTTTACCAAACATACTGAGAACGAAAACTTCAAGGATGATG

TTAGAAAAATGTGATTTAACTAGAACTTGTTTGATGTTAGCAAATCATGGAATGTTCTAAGTCTCTGAGGGTTTACTGTGAAGTGTTGAGGACAGTGTTG

ATGCCTAACTAGTTTTCTTAGATGGAAACAGAGACATTGAGCCCTCTCTCTTGATCGTAAACCACTCCAGAACGGCCACGGGTTTCCCAGAGTTCTATGG

TCTTCCCAAGAGAATTTTTAATTGTAAATGCAGACTTGGGAAGGACTTGGACTTTTAACCTGGTTTTGCTTTTGCTTTTCCTGACTCCCTTTGCTCAGAG

TCAGTTGCACACCAGTAGGATGGCATGCTACGATCAGTTTCTGTCCTGAAAGCTTTGCCTCTTTCTTGGCAAAGTTTCTGGTATGGTCAAGCTTGTAAAT

AACCTTTTTTACATTTTAATCTTTTCCATTAATTAAGAGGTTGAAAAGAAGTACAGTGTAAGAAAACCCAGCATTTTAATTATTTGCAAATTAAGGTGCC

ACAGACACAGACTTAGTGGTATGTAAATGTTGACTCGGATCACAATCATGTAGCAGAGGGCACTGGGCCTGTTGCCTGCCAGTCATGGACACCCATGTGA

AAAATCCTGATTTCCAGCTCATGGAGCCAGCGTTTGAACCTTGAACAAATAAATTTCATTTATGATTTTCTCATCAACATTTTCTTTGCTCTGTTTGTAG

CTGAATGTTACATTTTTTTAAAAATCTCTGTTCAAGCCAGAAGAGTTGATTATGAGTGGCCACAGCAACCCTGGCAAGCTGGGCCAAAAAATTTCAGTAG

GTCAGTAATTTAAACTTCACATCTGGAAAAAAAATTATTAATAATGTGAAACAAACCAACTTAAAAAGTGATTCTTGCACATGAATTGTCACATATTATA

TGTGTTTTTTAAAGAGCCTCAGTCTGACTGATTTCAAACACTTTTTTTCTCCTGTGTATTGCTTTTAAGAGAGCCATCAGTTAGCTATCAGAATCTAGGT

TGATGCATTTTTGTACTTAGCTGTACTGTGTGATATTTTTCATTATTTTAGGATGCCAACATGAGACCTGTAATAAAATATGTAATGGGGTTGAAGGCTG

GGGAGGAGGATCTACTGCTGTACAGCTAATAAATCATAACGGATTAACAGGC
Translation
 - UNI1642 -  - UNI1536 - MEGEAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMK

TEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGE

VETLEQGELPPQEDSSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEEEQQEGLLSEVNAEKVVGNMKPPKPTKIKKKG GVKKTFQCELCS

YTCPRRSNLDRHMKSHTDERPHKCHLCGRAFRTVTLLRNHLNTHTG GTRPHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYASVE - UNI80

17 - VSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSG GEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLG G

VHLRKQHSYIEQGKKCRYCDAVFHERYALIQHQKSHKNEKRFKCDQCDYACRQ - UNI33082 - ERHMIMHKRTHTGEKPYACSHCDKTFRQKQLLD

MHFKRYHDPNFVPAAFVCSKCGKTFTRR NTMARHADNCAGPDGVEGENGGETKKSKRGRKRKMRSKKEDSSDSE - UNI735 - EENAEPDLDDNEE

EEEPAVEIEPEPEPQPQPPPPPQPVAPAPPPAKKRRGRPPGRTNQPKQNQP PTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGEEEEAQAATTDAPNG

DLTPEMILSMMDR

For any suggestions or comments, please send an email to unitrap@crg.es