Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000005699 (Pard6a)
Chromosomal location
Chr 8: 108225054 - 108227393 (+)
Description
par-6 (partitioning defective 6,) homolog alpha (C. elegans) Gene [Source:MGI Symbol;Acc:MGI:1927223]
RefSeq_dna
NM_019695 NM_001047436 
RefSeq_peptide
NP_062669.2 NP_001040900.1 NP_001040901.1 
UniGene
Mm.472753 
MGI
MGI:1927223 
Uniprot/SWISSPROT
Q9Z101 
Uniprot/SPTREMBL
Q3TY70 
Human Ortholog
ENSG00000102981 (PARD6A)
Omim not available
UniTrap UNI31416
Vector Insertion
Chr 8: 108225704 - 108226073
Public Clones IST14385C2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000116431
Sequence
GGGCCGGGCTGTGCACCTGCGCCTCGGCGGGCTGCTGTGGGGCACTGTCCCCCGCCCGCCAGGCCCTGCAATGGCCAGGCCGCAGAGGACTCCGGCGCGC

AGTCCCGATAGCATCGTCGAGGTGAAGAGCAAA - UNI31416 - TTTGACGCCGAGTTCCGACGCTTTGCACTACCCCGCACTTCGGTGAGAGGCTT

TCAGGAGTTCTCGCGATTGCTGTGTGTGGTACACCAGATCCCTGGCCTGGACGTCCTGCTTGGCTATACGGATGCTCACGGTGACTTGCTGCCCCTCACC

AACGATGACAGTTTGCACCGGGCCCTGGCCAGCGGGCCCCCACCTCTGCGCCTCTTGGTTCAGAAACGGG CAGAAGGTGACTCGAGTGGCCTGGCTTTT

GCCTCCAACTCTCTACAAAGGCGCAAGAAAGGGCTCCTGCTACGACCAGTGGCACCTCTGCGCACCAGGCCACCCTTGTTAATCAGCTTGCCCCAAGATT

TCCGCCAGGTGTCTTCAGTTATAGATGTGGACCTACTACCTGAGACCCACCGACGAGTGAGGCTGCACAAACATGGTTCAGACCGTCCCCTGGGCTTCTA

CATTCGAGATGGCATGAGTGTTCGCGTGGCTCCCCAGGGCCTGGAGCGGGTTCCAGGTATCTTCATCTCCCGCCTGGTACGTGGGGGCCTGGCTGAGAGT

ACAGGGCTGCTGGCGGTCAGTGATGAGATCCTTGAGGTCAACGGCATTGAGGTGGCCGGGAAGACCTTGGACCAAGTGACGGACATGATGGTCGCCAACA

GCCACAACCTCATCGTCACTGTCAAGCCTGCCAACCAGCGTAATAATGTGGTACGGGGGGCATCTGGGCGTCTGACAGGGCCTTCCTCTGTAGGGCCTGG

GCCTACTGATCCTGACAGTGACGATGACAGCAGTGACCTGGTCATTGAGAATCGCCACCCTCCCTGTTCTAATGGGCTGTCTCAGGGGCCCCTGTGCTGG

GACCTGCAACCTGGCTGCCTACTTCCTGGTGCTGGCAGCTCTCTGCCCTCCTTGGATAGCAGAGAGCAAGCCAATTCTGGCTGGGGGAATGGCATGCGAG

GTGATGTTAGCGGATTCAGCCTCTGA
Translation
MARPQRTPARSPDSIVEVKSK - UNI31416 - FDAEFRRFALPRTSVRGFQEFSRLLCVVHQIPGLDVLLGYTDAHGDLLPLTNDDSLHRALASGPP

PLRLLVQKRA AEGDSSGLAFASNSLQRRKKGLLLRPVAPLRTRPPLLISLPQDFRQVSSVIDVDLLPETHRRVRLHKHGSDRPLGFYIRDGMSVRVAPQ

GLERVPGIFISRLVRGGLAESTGLLAVSDEILEVNGIEVAGKTLDQVTDMMVANSHNLIVTVKPANQRNNVVRGASGRLTGPSSVGPGPTDPDSDDDSSD

LVIENRHPPCSNGLSQGPLCWDLQPGCLLPGAGSSLPSLDSREQANSGWGNGMRGDVSGFSL
Transcript ENSMUST00000093195
Sequence
GGGCCGGGCTGTGCACCTGCGCCTCGGCGGGCTGCTGTGGGGCACTGTCCCCCGCCCGCCAGGCCCTGCAATGGCCAGGCCGCAGAGGACTCCGGCGCGC

AGTCCCGATAGCATCGTCGAGGTGAAGAGCAAA - UNI31416 - TTTGACGCCGAGTTCCGACGCTTTGCACTACCCCGCACTTCGGTGAGAGGCTT

TCAGGAGTTCTCGCGATTGCTGTGTGTGGTACACCAGATCCCTGGCCTGGACGTCCTGCTTGGCTATACGGATGCTCACGGTGACTTGCTGCCCCTCACC

AACGATGACAGTTTGCACCGGGCCCTGGCCAGCGGGCCCCCACCTCTGCGCCTCTTGGTTCAGAAACGGG AAGGTGACTCGAGTGGCCTGGCTTTTGCC

TCCAACTCTCTACAAAGGCGCAAGAAAGGGCTCCTGCTACGACCAGTGGCACCTCTGCGCACCAGGCCACCCTTGTTAATCAGCTTGCCCCAAGATTTCC

GCCAGGTGTCTTCAGTTATAGATGTGGACCTACTACCTGAGACCCACCGACGAGTGAGGCTGCACAAACATGGTTCAGACCGTCCCCTGGGCTTCTACAT

TCGAGATGGCATGAGTGTTCGCGTGGCTCCCCAGGGCCTGGAGCGGGTTCCAGGTATCTTCATCTCCCGCCTGGTACGTGGGGGCCTGGCTGAGAGTACA

GGGCTGCTGGCGGTCAGTGATGAGATCCTTGAGGTCAACGGCATTGAGGTGGCCGGGAAGACCTTGGACCAAGTGACGGACATGATGGTCGCCAACAGCC

ACAACCTCATCGTCACTGTCAAGCCTGCCAACCAGCGTAATAATGTGGTACGGGGGGCATCTGGGCGTCTGACAGGGCCTTCCTCTGTAGGGCCTGGGCC

TACTGATCCTGACAGTGACGATGACAGCAGTGACCTGGTCATTGAGAATCGCCACCCTCCCTGTTCTAATGGGCTGTCTCAGGGGCCCCTGTGCTGGGAC

CTGCAACCTGGCTGCCTACTTCCTGGTGCTGGCAGCTCTCTGCCCTCCTTGGATAGCAGAGAGCAAGCCAATTCTGGCTGGGGGAATGGCATGCGAGGTG

ATGTTAGCGGATTCAGCCTCTGACAGGCAAAGATGCAGCCCTTGTCACTTTAGGCTGCGGGAACATGGCCTGGACTTTCCAGCTGGGTAGAGAAGATTAG

CTTGCTCACAGAGCCCTCTCAGTCTGGTGAACATTAAAGGTTTTCTACAAATGT
Translation
MARPQRTPARSPDSIVEVKSK - UNI31416 - FDAEFRRFALPRTSVRGFQEFSRLLCVVHQIPGLDVLLGYTDAHGDLLPLTNDDSLHRALASGPP

PLRLLVQKRE EGDSSGLAFASNSLQRRKKGLLLRPVAPLRTRPPLLISLPQDFRQVSSVIDVDLLPETHRRVRLHKHGSDRPLGFYIRDGMSVRVAPQG

LERVPGIFISRLVRGGLAESTGLLAVSDEILEVNGIEVAGKTLDQVTDMMVANSHNLIVTVKPANQRNNVVRGASGRLTGPSSVGPGPTDPDSDDDSSDL

VIENRHPPCSNGLSQGPLCWDLQPGCLLPGAGSSLPSLDSREQANSGWGNGMRGDVSGFSL
Transcript ENSMUST00000098444
Sequence
GCGCCTGCGCAAGCTCTTCCCGGGTCCTGCTGACTGACCTAGCTGCTGGCTGATGACAGTTTATTCTTACCGGGGCATCTCTCTGAGCCCGTGAGCTGTT

CCTCAGTACAACTCTAGAGCCGGAAAGGAAAAGGCAAGGACTAGATTGGATGAGAGCGATCCAG - UNI31416 - TTTGACGCCGAGTTCCGACGCT

TTGCACTACCCCGCACTTCGGTGAGAGGCTTTCAGGAGTTCTCGCGATTGCTGTGTGTGGTACACCAGATCCCTGGCCTGGACGTCCTGCTTGGCTATAC

GGATGCTCACGGTGACTTGCTGCCCCTCACCAACGATGACAGTTTGCACCGGGCCCTGGCCAGCGGGCCCCCACCTCTGCGCCTCTTGGTTCAGAAACGG

G CAGAAGGTGACTCGAGTGGCCTGGCTTTTGCCTCCAACTCTCTACAAAGGCGCAAGAAAGGGCTCCTGCTACGACCAGTGGCACCTCTGCGCACCAGG

CCACCCTTGTTAATCAGCTTGCCCCAAGATTTCCGCCAGGTGTCTTCAGTTATAGATGTGGACCTACTACCTGAGACCCACCGACGAGTGAGGCTGCACA

AACATGGTTCAGACCGTCCCCTGGGCTTCTACATTCGAGATGGCATGAGTGTTCGCGTGGCTCCCCAGGGCCTGGAGCGGGTTCCAGGTATCTTCATCTC

CCGCCTGGTACGTGGGGGCCTGGCTGAGAGTACAGGGCTGCTGGCGGTCAGTGATGAGATCCTTGAGGTCAACGGCATTGAGGTGGCCGGGAAGACCTTG

GACCAAGTGACGGACATGATGGTCGCCAACAGCCACAACCTCATCGTCACTGTCAAGCCTGCCAACCAGCGTAATAATGTGGTACGGGGGGCATCTGGGC

GTCTGACAGGGCCTTCCTCTGTAGGGCCTGGGCCTACTGATCCTGACAGTGACGATGACAGCAGTGACCTGGTCATTGAGAATCGCCACCCTCCCTGTTC

TAATGGGCTGTCTCAGGGGCCCCTGTGCTGGGACCTGCAACCTGGCTGCCTACTTCCTGGTGCTGGCAGCTCTCTGCCCTCCTTGGATAGCAGAGAGCAA

GCCAATTCTGGCTGGGGGAATGGCATGCGAGGTGATGTTAGCGGATTCAGCCTCTGACAGGCAAAGATGCAGCCCTTGTCACTTTAGGCTGCGGGAACAT

GGCCTGGACTTTCCAGCTGGGTAGAGAAGATTAGCTTGCTCACAGAGCCCTCTCAGTCTGGTGAACATTAAAGGTTTTCTACAAATGT
Translation
MRAIQ - UNI31416 - FDAEFRRFALPRTSVRGFQEFSRLLCVVHQIPGLDVLLGYTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKRA AEGDS

SGLAFASNSLQRRKKGLLLRPVAPLRTRPPLLISLPQDFRQVSSVIDVDLLPETHRRVRLHKHGSDRPLGFYIRDGMSVRVAPQGLERVPGIFISRLVRG

GLAESTGLLAVSDEILEVNGIEVAGKTLDQVTDMMVANSHNLIVTVKPANQRNNVVRGASGRLTGPSSVGPGPTDPDSDDDSSDLVIENRHPPCSNGLSQ

GPLCWDLQPGCLLPGAGSSLPSLDSREQANSGWGNGMRGDVSGFSL

For any suggestions or comments, please send an email to unitrap@crg.es