Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000005774 (Rfx5)
Chromosomal location
Chr 3: 94757997 - 94765483 (+)
Description
regulatory factor X, 5 (influences HLA class II expression) Gene [Source:MGI (curated);Acc:Rfx5-004]
RefSeq_dna
NM_017395 
RefSeq_peptide
NP_059091.2 
UniGene
Mm.24308 
MGI
MGI:1858421 
Uniprot/SPTREMBL
Q6DI69 Q0P5W9 Q3U180 Q9JL61 
Human Ortholog
ENSG00000143390 (RFX5)
Omim 209920 - BARE LYMPHOCYTE SYNDROME, TYPE II  
UniTrap UNI33209
Vector Insertion
Chr 3: 94758684 - 94758712
Public Clones IST14506A12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30125
Vector Insertion
Chr 3: 94758807 - 94758936
Public Clones D110A12 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19094
Vector Insertion
Chr 3: 94758942 - 94759069
Public Clones not available
Private Clones OST404897 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36639
Vector Insertion
Chr 3: 94762171 - 94765272
Public Clones IST13630D10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107253
Sequence
CCGTGCTGGAAGGCGACGGTTCCGAG - UNI30125 - - UNI33209 - CTGTAGCCCTCATGCTGGGATGGCAGAAGATAAACCTGATGCTAAGA

GCCCCAAGACTGGGGCAAGGCCCCAAGGTGGTGCTGACGCTGGAGAACCTACCACCCTCCTCCAAAGGCTCCGAGGTACCATTTC - UNI19094 - C

AAGGCCGTGCAGAACAAAGTAGAGGGAATTCTG CAAGAAGTACAGAAATTCTCGGACAACGACAAGCTGTACCTCTACCTTCAGCTCCCATCGGGGCCC

AGCGTTGGCGAGAAGAG CTCAGAGCCAAGTCTGCTCAGCAATGAGGAGTATATGTATGCCTATAGGTGGATCCGCAACCACCTGGAAGAGCACATGGAT

ACCTGCCTGCCAAAGCAGAGCGTCTATGATGCCTATCG AAAGTACTGCGAGAGCCTCGCCTGTTGCCGCCCGCTCAGCACAGCCAACTTCGGTAAAATC

ATCAGAGAGATCTTCCCTGACATCAAGGCCCGAAGACTCGGTGGCCGGGGCCAGTCCAA ATATTGCTACAGTGGCATTCGAAGGAAGACCTTGGTATCC

ATGCCACCATTGCCTGGACTCGACTTGAAGGGATCTGAAAGT CCAGAAATGGGCCCAGAAGTAAGCCCAGCACCTCGGGATGAACTGGTAGAAGCAGCC

TGTGCCCTGACTTGTGACTGGGCAGAGCGGATCCTGAAGCGGTCCTTCAGTTCCATCGTCCAGGTCGCCCGCTACCTCCTGCAGCAGCATCTCATCTCTG

CCCGGTCGGCACATGCTCATGTGCTTAAGGCCGGGGGGCTTGCTG AAGAGGATGAAAGAGCCCCTCGAGAACGGTCATTATGTAAGTCCAAGAATGTCG

TAGAAAGCCTGGAAGGGGGAGGCCCTAAGAAACCAGAGAGACCGGCCCAGGTAAGGCCGCTGGTGCCCAGGGCTTGGGGTCTTAATGGACCCTCCTGGCA

GTGACCCTTCTACATCTTCACTTCTCCCTTTCTTCCTGTGCTCAGTCTTCTATTTTATTTTATTAGTTATTTTTAGATTTATTTTCCGTGTATGTACGTT

TTGCCTGTGTGCATGTATGTGGACCATGTGTGCCTGGTGTCCAAGGGGAGAAGACTTTAGATCCCCTGGAACTAGAGTCATTATTGTAAGCCAGCTGCCA

TGTGGGTACTGGGATCCTCTGCAGGAACAACAAATTCTCCTAACCCTTGAGCCATTTCTCCAGCCTCTGAATTTATAGCCTTTATACCTTACTGTGGCTC

TGTTTGCATTTTAGCCTCCTAAAGAGCAAGAAGCCCGAGCTGGGACAGACCTTCCAGGGCGTGCAGAACGGAAGAAGAGTGTAATTGACAGCTCGGTTCC

AGCAGCCAGTAAGCCACAAGTTAATGCTCTTGTGGCCCGACTGCCTGTGCTGCTTCCAAGAGCACCACGATCACTTATCACACCCATTTCAGGCACTCTG

AAAGTAGCTACGCTGCCTCTACCCACTAGGGTTGGAGGGCCCCAGACAGCTGTGCCCATCATCAACATGATCTTACCACCTGTTCCTACTTTGTCAGGGG

CTGGGCCTGGGCCTGGGCCTGGCCTTGGGCCTAGGTTTGGGCCAGGGCCTGGGCTTGGGCCTGGGCCGGGGCCTGGTCTGGGGGCTGGTCTGGGGCCTGG

GTTAGGGCCTGGGCTTGGAGCTGGACCAGGGCCCGGGCTTGGAGCTGGGCTTGGGGCTGGCCTAGGGCTTGGGCCTGGGCGAGTTCCACCTAGAGCACCC

ATTCTGCCTCGAGGTGCAGAGAACAGGGAGGTAGGCATAAGTAGTGATCCAAGACCTCATGACAAGGGTATCAAAAGGACAGCTGAAGTGCCTCTGAGTG

AGGCCAGTGGGCAGGACCCACCAGTTAAAGAAATGAAGCACGAAACACAGGATACTACAGTAAGTGAAGCAAAAAGGAAGCGAGGACGCCCTCGAAAGAA

GCCAGGAGGGAGTGGGGAAAGAAACGCTACTCCTGAGAAGTCTGCAGCTATTGTGAACTCTCCCCGATCCCCAAGGCTACTCTGGGAGACATGGGGCTCA

AAAAGAGAAAACAACTTCATTGGGAGACCAGAAGGACCAGGGCCAGGGGGTGAGGCTGAGCGGGAAACAGTGCTTGTGCAAGGTCAGCAAGATGGTGCTG

TTTCCAAAGGAGAAAGGAGCTTGAGTTCCCAGGAAGCCAAAGAAGCAGAAGATAAAATTCCTCCTGTCACTTCAAAAGTGAGTGTTATCAAGGGCAGAAT

TCAAAAAGAGGCTCTTCAGTTGGTAAAGGGAGAGGCTGATGCTGCAACACAGGGCAACAAAGGGTTAAAGGGTCGTGTACTTCAAAGTTCCCTAACCCCT

GAGCATAAAGACCCCAAAGCAACACCCCCATGATAGACAGATAGGTCTGTGGGGGAAGAGTGGCTATGTTCATGTGAGCTCTGCCTGCTGCCTGGCAGAG

GCCCTTCACTGAGCCTCCTTCTCATCCAGCTAGTCTTCCCCCACAGGGAACCCAGTGGCCTGGCTTGCTTTGTGCCTCGTGGCTGCTTCAGGCCTTTCTA

GCTCAGTACCATGGCTTTAATACAAACAGCAAATCTGTAATGACTTCCCACCTATATCCCTGTGTTCTCCTAGGAGATAGGGTAAGTAGGTTAGGGATAT

TCTGGCTTCTAATCATAGGGAACTTAACTCAAAACTCATTAAAGATAAAAGCAGTTTATCAGCTGAAGTTGCAGAATCAAGAGGCAGTCCTGGCTGCAGG

TGAGGCTTGATCTGATTGCACACTCTGTTCTTCTGCTTCACATAATGTAAAACCATCCTTAGTTTGGACCACTTCACAGCCACCAACACTCCCAGGCTTC

TGTTTGACCGTTATATCTAAGCAGAAAGAAAGGGTATCTATCATTGTGCCAGGAATCCTAGCAAAAGCCCAAAGATTTACCATGATTAACCAGCCAAGGT

CAGTTCCACCCTTGGCCAGCTAGTATGGCCAGGAAGATGTTTATGCAAATGTGTCTCTACACATCGTGGACCACCCTTGGGAAAGGGTGGAGTCCGCCGT

CTCACAGTCCCAGGTTCCCCAGATGGAGGCTTGGGTGGAGGATGGAATTGTTGCTGGGGAGCAGCTAACGACCGCTGGGTGCGGTTTAGCTTGCTAGGCT

GGGATGAGCTGGACTGCTGCCTGTCCCCTGAACCTTGCATCTCCCTCAGTGCAGCTCTAACTTTTATCTCATTGTAGCCTCGGAAGGACAGAGAAGGAAG

CCATTCTCGTTAGTCTCTTCATTCTTACAGGACAGCTTTCGCACCTCTGTCTCCCAGAACAAGCTCCTTTTAGGGTCTGAATCTTAAACTTTCTCCGCAG

CCGTGTTTCCTACCTCCCAACCTAGTGTCACCTTCTCAGAGGATATGAATGCCCCTCCCAAGCCATTTCATTACATTACCTTCATTCTGCAGCCACCAGA

TGTCATGCACTTGTCACATGTGTCAGGACCTAGCCAGGACTGTGGGCTTAGGCTGGATTAACAGATGCTGCGAGTCAGGGAGCACCTGCAGGAAGGATGC

AGACGCTCCAGCTGTGTCCTTGGGAACAGCAGGAAACCAGCCCATATTAATCAAGGACCTACTCCGTCCTCCCCACAGGACAGCTTCTTGTCAGGGAATC

TTGGTTTTATTCCCAAGAAATAGATTTTCTTTCAGGGAGATACCACCCATTTGTCCATTTATTTCCATGAGAACAGATTTTTTAAAAATTATAAGTAATC

TTTGATATCTATAAAGAAATATGTACTATAAATTATGAAATGCAATGAATACCTATGACCCATCATTCAATTTATACATTGAAAGTAGTTTTTTCCCCCT

TGCCCGGCCTCTTCCTAGAGGTAATCACTGTCTTTAATTTTTGGTTATTAATCATTTGTTTATATATATTGGCCATGTGTATATATATTCTTTAGGAATG

TATAATTTTGTATTGCTTGTATTTTTAGCTTTAAAAAATGTTGTCCTGTGTTCCTTGAGGTTTGCTTTTTTGCACTTACCCATTGTTTCTCCGACTCCTC

TGTTGTAATTGCTATGACTTGTTCCTCTGCATCTGTATAATACCCCATCAAGCAACTTAGCCACTCACCTACTGAGTAACACTTGGGCTGTCGGCAGGCT

TCTGTTATTATACACAATGCTGCTATGAACATTCTTGTATATGAGTGCCTTTGTTTTTAGTAAGATTTCTAAAGAGGTTTCTAAGATGGTCCTTTTGGTC

TGTGTACCCTCTGAGCTGGGGACTGTTGCCTCTTGTCTTACTTTATGGAAGAGTTTACATCACATAGAAATGAACTGTTCTTGAATGTTTGATAAAAACT

CACCTATAAAGCCA
Translation
 - UNI30125 - - UNI33209 - MAEDKPDAKSPKTGARPQGGADAGEPTTLLQRLRGTIS - UNI19094 - SKAVQNKVEGIL QEVQKFSD

NDKLYLYLQLPSGPSVGEKS SSEPSLLSNEEYMYAYRWIRNHLEEHMDTCLPKQSVYDAYR RKYCESLACCRPLSTANFGKIIREIFPDIKARRLGGR

GQSK KYCYSGIRRKTLVSMPPLPGLDLKGSES PEMGPEVSPAPRDELVEAACALTCDWAERILKRSFSSIVQVARYLLQQHLISARSAHAHVLKAGGL

AE EEDERAPRERSLCKSKNVVESLEGGGPKKPERPAQVRPLVPRAWGLNGPSWQ
Transcript ENSMUST00000107254
Sequence
GCAGGAGCTGAGGTAGCCACAGGGTAGTTTCTCTTTCTCTCTCACCTATCTAATGTCCGTGCTGGAAGGCGACGGTTCCGAG - UNI33209 - TTTT

CCAGATTTGGGAGACTTCAAAAG - UNI30125 - - UNI33209 - CTGTAGCCCTCATGCTGGGATGGCAGAAGATAAACCTGATGCTAAGAGCC

CCAAGACTGGGGCAAGGCCCCAAGGTGGTGCTGACGCTGGAGAACCTACCACCCTCCTCCAAAGGCTCCGAGGTACCATTTC - UNI19094 - CAAG

GCCGTGCAGAACAAAGTAGAGGGAATTCTG CAAGAAGTACAGAAATTCTCGGACAACGACAAGCTGTACCTCTACCTTCAGCTCCCATCGGGGCCCAGC

GTTGGCGAGAAGAG CTCAGAGCCAAGTCTGCTCAGCAATGAGGAGTATATGTATGCCTATAGGTGGATCCGCAACCACCTGGAAGAGCACATGGATACC

TGCCTGCCAAAGCAGAGCGTCTATGATGCCTATCG AAAGTACTGCGAGAGCCTCGCCTGTTGCCGCCCGCTCAGCACAGCCAACTTCGGTAAAATCATC

AGAGAGATCTTCCCTGACATCAAGGCCCGAAGACTCGGTGGCCGGGGCCAGTCCAA ATATTGCTACAGTGGCATTCGAAGGAAGACCTTGGTATCCATG

CCACCATTGCCTGGACTCGACTTGAAGGGATCTGAAAGT CCAGAAATGGGCCCAGAAGTAAGCCCAGCACCTCGGGATGAACTGGTAGAAGCAGCCTGT

GCCCTGACTTGTGACTGGGCAGAGCGGATCCTGAAGCGGTCCTTCAGTTCCATCGTCCAGGTCGCCCGCTACCTCCTGCAGCAGCATCTCATCTCTGCCC

GGTCGGCACATGCTCATGTGCTTAAGGCCGGGGGGCTTGCTG AAGAGGATGAAAGAGCCCCTCGAGAACGGTCATTATGTAAGTCCAAGAATGTCGTAG

AAAGCCTGGAAGGGGGAGGCCCTAAGAAACCAGAGAGACCGGCCCAGGTAAGGCCGCTGGTGCCCAGGGCTTGGGGTCTTAATGGACCCTCCTGGCAGTG

ACCCTTCTACATCTTCACTTCTCCCTTTCTTCCTGTGCTCAGTCTTCTATTTTATTTTATTAGTTATTTTTAGATTTATTTTCCGTGTATGTACGTTTTG

CCTGTGTGCATGTATGTGGACCATGTGTGCCTGGTGTCCAAGGGGAGAAGACTTTAGATCCCCTGGAACTAGAGTCATTATTGTAAGCCAGCTGCCATGT

GGGTACTGGGATCCTCTGCAGGAACAACAAATTCTCCTAACCCTTGAGCCATTTCTCCAGCCTCTGAATTTATAGCCTTTATACCTTACTGTGGCTCTGT

TTGCATTTTAGCCTCCTAAAGAGCAAGAAGCCCGAGCTGGGACAGACCTTCCAGGGCGTGCAGAACGGAAGAAGAGTGTAATTGACAGCTCGGTTCCAGC

AGCCAGTAAGCCACAAGTTAATGCTCTTGTGGCCCGACTGCCTGTGCTGCTTCCAAGAGCACCACGATCACTTATCACACCCATTTCAGGCACTCTGAAA

GTAGCTACGCTGCCTCTACCCACTAGGGTTGGAGGGCCCCAGACAGCTGTGCCCATCATCAACATGATCTTACCACCTGTTCCTACTTTGTCAGGGGCTG

GGCCTGGGCCTGGGCCTGGCCTTGGGCCTAGGTTTGGGCCAGGGCCTGGGCTTGGGCCTGGGCCGGGGCCTGGTCTGGGGGCTGGTCTGGGGCCTGGGTT

AGGGCCTGGGCTTGGAGCTGGACCAGGGCCCGGGCTTGGAGCTGGGCTTGGGGCTGGCCTAGGGCTTGGGCCTGGGCGAGTTCCACCTAGAGCACCCATT

CTGCCTCGAGGTGCAGAGAACAGGGAGGTAGGCATAAGTAGTGATCCAAGACCTCATGACAAGGGTATCAAAAGGACAGCTGAAGTGCCTCTGAGTGAGG

CCAGTGGGCAGGACCCACCAGTTAAAGAAATGAAGCACGAAACACAGGATACTACAGTAAGTGAAGCAAAAAGGAAGCGAGGACGCCCTCGAAAGAAGCC

AGGAGGGAGTGGGGAAAGAAACGCTACTCCTGAGAAGTCTGCAGCTATTGTGAACTCTCCCCGATCCCCAAGGCTACTCTGGGAGACATGGGGCTCAAAA

AGAGAAAACAACTTCATTGGGAGACCAGAAGGACCAGGGCCAGGGGGTGAGGCTGAGCGGGAAACAGTGCTTGTGCAAGGTCAGCAAGATGGTGCTGTTT

CCAAAGGAGAAAGGAGCTTGAGTTCCCAGGAAGCCAAAGAAGCAGAAGATAAAATTCCTCCTGTCACTTCAAAAGTGAGTGTTATCAAGGGCAGAATTCA

AAAAGAGGCTCTTCAGTTGGTAAAGGGAGAGGCTGATGCTGCAACACAGGGCAACAAAGGGTTAAAGGGTCGTGTACTTCAAAGTTCCCTAACCCCTGAG

CATAAAGACCCCAAAGCAACACCCCCATGATAGACAGATAGGTCTGTGGGGGAAGAGTGGCTATGTTCATGTGAGCTCTGCCTGCTGCCTGGCAGAGGCC

CTTCACTGAGCCTCCTTCTCATCCAGCTAGTCTTCCCCCACAGGGAACCCAGTGGCCTGGCTTGCTTTGTGCCTCGTGGCTGCTTCAGGCCTTTCTAGCT

CAGTACCATGGCTTTAATACAAACAGCAAATCTGTAATGACTTCCCACCTATATCCCTGTGTTCTCCTAGGAGATAGGGTAAGTAGGTTAGGGATATTCT

GGCTTCTAATCATAGGGAACTTAACTCAAAACTCATTAAAGATAAAAGCAGTTTATCAGCTGAAGTTGCAGAATCAAGAGGCAGTCCTGGCTGCAGGTGA

GGCTTGATCTGATTGCACACTCTGTTCTTCTGCTTCACATAATGTAAAACCATCCTTAGTTTGGACCACTTCACAGCCACCAACACTCCCAGGCTTCTGT

TTGACCGTTATATCTAAGCAGAAAGAAAGGGTATCTATCATTGTGCCAGGAATCCTAGCAAAAGCCCAAAGATTTACCATGATTAACCAGCCAAGGTCAG

TTCCACCCTTGGCCAGCTAGTATGGCCAGGAAGATGTTTATGCAAATGTGTCTCTACACATCGTGGACCACCCTTGGGAAAGGGTGGAGTCCGCCGTCTC

ACAGTCCCAGGTTCCCCAGATGGAGGCTTGGGTGGAGGATGGAATTGTTGCTGGGGAGCAGCTAACGACCGCTGGGTGCGGTTTAGCTTGCTAGGCTGGG

ATGAGCTGGACTGCTGCCTGTCCCCTGAACCTTGCATCTCCCTCAGTGCAGCTCTAACTTTTATCTCATTGTAGCCTCGGAAGGACAGAGAAGGAAGCCA

TTCTCGTTAGTCTCTTCATTCTTACAGGACAGCTTTCGCACCTCTGTCTCCCAGAACAAGCTCCTTTTAGGGTCTGAATCTTAAACTTTCTCCGCAGCCG

TGTTTCCTACCTCCCAACCTAGTGTCACCTTCTCAGAGGATATGAATGCCCCTCCCAAGCCATTTCATTACATTACCTTCATTCTGCAGCCACCAGATGT

CATGCACTTGTCACATGTGTCAGGACCTAGCCAGGACTGTGGGCTTAGGCTGGATTAACAGATGCTGCGAGTCAGGGAGCACCTGCAGGAAGGATGCAGA

CGCTCCAGCTGTGTCCTTGGGAACAGCAGGAAACCAGCCCATATTAATCAAGGACCTACTCCGTCCTCCCCACAGGACAGCTTCTTGTCAGGGAATCTTG

GTTTTATTCCCAAGAAATAGATTTTCTTTCAGGGAGATACCACCCATTTGTCCATTTATTTCCATGAGAACAGATTTTTTAAAAATTATAAGTAATCTTT

GATATCTATAAAGAAATATGTACTATAAATTATGAAATGCAATGAATACCTATGACCCATCATTCAATTTATACATTGAAAGTAGTTTTTTCCCCCTTGC

CCGGCCTCTTCCTAGAGGTAATCACTGTCTTTAATTTTTGGTTATTAATCATTTGTTTATATATATTGGCCATGTGTATATATATTCTTTAGGAATGTAT

AATTTTGTATTGCTTGTATTTTTAGCTTTAAAAAATGTTGTCCTGTGTTCCTTGAGGTTTGCTTTTTTGCACTTACCCATTGTTTCTCCGACTCCTCTGT

TGTAATTGCTATGACTTGTTCCTCTGCATCTGTATAATACCCCATCAAGCAACTTAGCCACTCACCTACTGAGTAACACTTGGGCTGTCGGCAGGCTTCT

GTTATTATACACAATGCTGCTATGAACATTCTTGTATATGAGTGCCTTTGTTTTTAGTAAGATTTCTAAAGAGGTTTCTAAGATGGTCCTTTTGGTCTGT

GTACCCTCTGAGCTGGGGACTGTTGCCTCTTGTCTTACTTTATGGAAGAGTTTACATCACATAGAAATGAACTGTTCTTGAATGTTTGATAAAAACTCAC

CTATAAAGCCA
Translation
 - UNI33209 -  - UNI30125 - - UNI33209 - MAEDKPDAKSPKTGARPQGGADAGEPTTLLQRLRGTIS - UNI19094 - SKAVQNK

VEGIL QEVQKFSDNDKLYLYLQLPSGPSVGEKS SSEPSLLSNEEYMYAYRWIRNHLEEHMDTCLPKQSVYDAYR RKYCESLACCRPLSTANFGKIIR

EIFPDIKARRLGGRGQSK KYCYSGIRRKTLVSMPPLPGLDLKGSES PEMGPEVSPAPRDELVEAACALTCDWAERILKRSFSSIVQVARYLLQQHLIS

ARSAHAHVLKAGGLAE EEDERAPRERSLCKSKNVVESLEGGGPKKPERPAQVRPLVPRAWGLNGPSWQ
Transcript ENSMUST00000090837
Sequence
TTTTCCAGATTTGGGAGACTTCAAAAGGTGGGACATATAGAATGGAGATGTCAGAGATCTCTTTGGGTATACAAGGGCCTGATAAAGTAACAGAATAATT

CTAATTTTAGAGAAG - UNI19094 - - UNI30125 - CCCTCATGCTGGGATGGCAGAAGATAAACCTGATGCTAAGAGCCCCAAGACTGGGGCA

AGGCCCCAAGGTGGTGCTGACGCTGGAGAACCTACCACCCTCCTCCAAAGGCTCCGAGGTACCATTTC - UNI19094 - CAAGGCCGTGCAGAACAA

AGTAGAGGGAATTCTG CAAGAAGTACAGAAATTCTCGGACAACGACAAGCTGTACCTCTACCTTCAGCTCCCATCGGGGCCCAGCGTTGGCGAGAAGAG

 CTCAGAGCCAAGTCTGCTCAGCAATGAGGAGTATATGTATGCCTATAGGTGGATCCGCAACCACCTGGAAGAGCACATGGATACCTGCCTGCCAAAGCA

GAGCGTCTATGATGCCTATCG AAAGTACTGCGAGAGCCTCGCCTGTTGCCGCCCGCTCAGCACAGCCAACTTCGGTAAAATCATCAGAGAGATCTTCCC

TGACATCAAGGCCCGAAGACTCGGTGGCCGGGGCCAGTCCAA ATATTGCTACAGTGGCATTCGAAGGAAGACCTTGGTATCCATGCCACCATTGCCTGG

ACTCGACTTGAAGGGATCTGAAAGT CCAGAAATGGGCCCAGAAGTAAGCCCAGCACCTCGGGATGAACTGGTAGAAGCAGCCTGTGCCCTGACTTGTGA

CTGGGCAGAGCGGATCCTGAAGCGGTCCTTCAGTTCCATCGTCCAGGTCGCCCGCTACCTCCTGCAGCAGCATCTCATCTCTGCCCGGTCGGCACATGCT

CATGTGCTTAAGGCCGGGGGGCTTGCTG AAGAGGATGAAAGAGCCCCTCGAGAACGGTCATTATGTAAGTCCAAGAATGTCGTAGAAAGCCTGGAAGGG

GGAGGCCCTAAGAAACCAGAGAGACCGGCCCAG CCTCCTAAAGAGCAAGAAGCCCGAGCTGGGACAGACCTTCCAGGGCGTGCAGAACGGAAGAAGAGT

GTAATTGACAGCTCGGTTCCAGCAGCCAGTAAGCCACAAGTTAATGCTCTTGTGGCCCGACTGCCTGTGCTGCTTCCAAGAGCACCACGATCACTTATCA

CACCCATTTCAGGCACTCTGAAAGTAGCTACGCTGCCTCTACCCACTAGGGTTGGAGGGCCCCAGACAGCTGTGCCCATCATCAACATGATCTTACCACC

TGTTCCTACTTTGTCAGGGGCTGGGCCTGGGCCTGGGCCTGGCCTTGGGCCTAGGTTTGGGCCAGGGCCTGGGCTTGGGCCTGGGCCGGGGCCTGGTCTG

GGGGCTGGTCTGGGGCCTGGGTTAGGGCCTGGGCTTGGAGCTGGACCAGGGCCCGGGCTTGGAGCTGGGCTTGGGGCTGGCCTAGGGCTTGGGCCTGGGC

GAGTTCCACCTAGAGCACCCATTCTGCCTCGAGGTGCAGAGAACAGGGAGGTAGGCATAAGTAGTGATCCAAGACCTCATGACAAGGGTATCAAAAGGAC

AGCTGAAGTGCCTCTGAGTGAGGCCAGTGGGCAGGACCCACCAGTTAAAGAAATGAAGCACGAAACACAGGATACTACAGTAAGTGAAGCAAAAAGGAAG

CGAGGACGCCCTCGAAAGAAGCCAGGAGGGAGTGGGGAAAGAAACGCTACTCCTGAGAAGTCTGCAGCTATTGTGAACTCTCCCCGATCCCCAAGGCTAC

TCTGGGAGACATGGGGCTCAAAAAGAGAAAACAACTTCATTGGGAGACCAGAAGGACCAGGGCCAGGGGGTGAGGCTGAGCGGGAAACAGTGCTTGTGCA

AGGTCAGCAAGATGGTGCTGTTTCCAAAGGAGAAAGGAGCTTGAGTTCCCAGGAAGCCAAAGAAGCAGAAGATAAAATTCCTCCTGTCACTTCAAAAGTG

AGTGTTATCAAGGGCAGAATTCAAAAAGAGGCTCTTCAGTTGGTAAAGGGAGAGGCTGATGCTGCAACACAGGGCAACAAAGGGTTAAAGGGTCGTGTAC

TTCAAAGTTCCCTAACCCCTGAGCATAAAGACCCCAAAGCAACACCCCCATGATAGACAGATAGGTCTGTGGGGGAAGAGTGGCTATGTTCATGTGAGCT

CTGCCTGCTGCCTGGCAGAGGCCCTTCACTGAGCCTCCTTCTCATCCAGCTAGTCTTCCCCCACAGGGAACCCAGTGGCCTGGCTTGCTTTGTGCCTCGT

GGCTGCTTCAGGCCTTTCTAGCTCAGTACCATGGCTTTAATACAAACAGCAAATCTGTAATGAC
Translation
 - UNI19094 - - UNI30125 - MAEDKPDAKSPKTGARPQGGADAGEPTTLLQRLRGTIS - UNI19094 - SKAVQNKVEGIL QEVQKFSD

NDKLYLYLQLPSGPSVGEKS SSEPSLLSNEEYMYAYRWIRNHLEEHMDTCLPKQSVYDAYR RKYCESLACCRPLSTANFGKIIREIFPDIKARRLGGR

GQSK KYCYSGIRRKTLVSMPPLPGLDLKGSES PEMGPEVSPAPRDELVEAACALTCDWAERILKRSFSSIVQVARYLLQQHLISARSAHAHVLKAGGL

AE EEDERAPRERSLCKSKNVVESLEGGGPKKPERPAQ PPKEQEARAGTDLPGRAERKKSVIDSSVPAASKPQVNALVARLPVLLPRAPRSLITPISGT

LKVATLPLPTRVGGPQTAVPIINMILPPVPTLSGAGPGPGPGLGPRFGPGPGLGPGPGPGLGAGLGPGLGPGLGAGPGPGLGAGLGAGLGLGPGRVPPRA

PILPRGAENREVGISSDPRPHDKGIKRTAEVPLSEASGQDPPVKEMKHETQDTTVSEAKRKRGRPRKKPGGSGERNATPEKSAAIVNSPRSPRLLWETWG

SKRENNFIGRPEGPGPGGEAERETVLVQGQQDGAVSKGERSLSSQEAKEAEDKIPPVTSKVSVIKGRIQKEALQLVKGEADAATQGNKGLKGRVLQSSLT

PEHKDPKATPP
Transcript ENSMUST00000107255
Sequence
TTTTCCAGATTTGGGAGACTTCAAAAGGTGGGACATATAGAATGGAGATGTCAGAGATCTCTTTGGGTATACAAGGGCCTGATAAAGTAACAGAATAATT

CTAATTTTAGAGAAGGCAAGTG - UNI19094 - - UNI30125 - CCCTCATGCTGGGATGGCAGAAGATAAACCTGATGCTAAGAGCCCCAAGAC

TGGGGCAAGGCCCCAAGGTGGTGCTGACGCTGGAGAACCTACCACCCTCCTCCAAAGGCTCCGAGGTACCATTTC - UNI19094 - CAAGGCCGTGC

AGAACAAAGTAGAGGGAATTCTG CAAGAAGTACAGAAATTCTCGGACAACGACAAGCTGTACCTCTACCTTCAGCTCCCATCGGGGCCCAGCGTTGGCG

AGAAGAG CTCAGAGCCAAGTCTGCTCAGCAATGAGGAGTATATGTATGCCTATAGGTGGATCCGCAACCACCTGGAAGAGCACATGGATACCTGCCTGC

CAAAGCAGAGCGTCTATGATGCCTATCG AAAGTACTGCGAGAGCCTCGCCTGTTGCCGCCCGCTCAGCACAGCCAACTTCGGTAAAATCATCAGAGAGA

TCTTCCCTGACATCAAGGCCCGAAGACTCGGTGGCCGGGGCCAGTCCAA ATATTGCTACAGTGGCATTCGAAGGAAGACCTTGGTATCCATGCCACCAT

TGCCTGGACTCGACTTGAAGGGATCTGAAAGT CCAGAAATGGGCCCAGAAGTAAGCCCAGCACCTCGGGATGAACTGGTAGAAGCAGCCTGTGCCCTGA

CTTGTGACTGGGCAGAGCGGATCCTGAAGCGGTCCTTCAGTTCCATCGTCCAGGTCGCCCGCTACCTCCTGCAGCAGCATCTCATCTCTGCCCGGTCGGC

ACATGCTCATGTGCTTAAGGCCGGGGGGCTTGCTG AAGAGGATGAAAGAGCCCCTCGAGAACGGTCATTATGTAAGTCCAAGAATGTCGTAGAAAGCCT

GGAAGGGGGAGGCCCTAAGAAACCAGAGAGACCGGCCCAG CCTCCTAAAGAGCAAGAAGCCCGAGCTGGGACAGACCTTCCAGGGCGTGCAGAACGGAA

GAAGAGTGTAATTGACAGCTCGGTTCCAGCAGCCAGTAAGCCACAAGTTAATGCTCTTGTGGCCCGACTGCCTGTGCTGCTTCCAAGAGCACCACGATCA

CTTATCACACCCATTTCAGGCACTCTGAAAGTAGCTACGCTGCCTCTACCCACTAGGGTTGGAGGGCCCCAGACAGCTGTGCCCATCATCAACATGATCT

TACCACCTGTTCCTACTTTGTCAGGGGCTGGGCCTGGGCCTGGGCCTGGCCTTGGGCCTAGGTTTGGGCCAGGGCCTGGGCTTGGGCCTGGGCCGGGGCC

TGGTCTGGGGGCTGGTCTGGGGCCTGGGTTAGGGCCTGGGCTTGGAGCTGGACCAGGGCCCGGGCTTGGAGCTGGGCTTGGGGCTGGCCTAGGGCTTGGG

CCTGGGCGAGTTCCACCTAGAGCACCCATTCTGCCTCGAGGTGCAGAGAACAGGGAGGTAGGCATAAGTAGTGATCCAAGACCTCATGACAAGGGTATCA

AAAGGACAGCTGAAGTGCCTCTGAGTGAGGCCAGTGGGCAGGACCCACCAGTTAAAGAAATGAAGCACGAAACACAGGATACTACAGTAAGTGAAGCAAA

AAGGAAGCGAGGACGCCCTCGAAAGAAGCCAGGAGGGAGTGGGGAAAGAAACGCTACTCCTGAGAAGTCTGCAGCTATTGTGAACTCTCCCCGATCCCCA

AGGCTACTCTGGGAGACATGGGGCTCAAAAAGAGAAAACAACTTCATTGGGAGACCAGAAGGACCAGGGCCAGGGGGTGAGGCTGAGCGGGAAACAGTGC

TTGTGCAAGGTCAGCAAGATGGTGCTGTTTCCAAAGGAGAAAGGAGCTTGAGTTCCCAGGAAGCCAAAGAAGCAGAAGATAAAATTCCTCCTGTCACTTC

AAAAGTGAGTGTTATCAAGGGCAGAATTCAAAAAGAGGCTCTTCAGTTGGTAAAGGGAGAGGCTGATGCTGCAACACAGGGCAACAAAGGGTTAAAGGGT

CGTGTACTTCAAAGTTCCCTAACCCCTGAGCATAAAGACCCCAAAGCAACACCCCCATGATAGACAGATAGGTCTGTGGGGGAAGAGTGGCTATGTTCAT

GTGAGCTCTGCCTGCTGCCTGGCAGAGGCCCTTCACTGAGCCTCCTTCTCATCCAGCTAGTCTTCCCCCACAGGGAACCCAGTGGCCTGGCTTGCTTTGT

GCCTCGTGGCTGCTTCAGGCCTTTCTAGCTCAGTACCATGGCTTTAATACAAACAGCAAATCTGTAATGACTTCCCACCTATATCCCTGTGTTCTCCT
Translation
 - UNI19094 - - UNI30125 - MAEDKPDAKSPKTGARPQGGADAGEPTTLLQRLRGTIS - UNI19094 - SKAVQNKVEGIL QEVQKFSD

NDKLYLYLQLPSGPSVGEKS SSEPSLLSNEEYMYAYRWIRNHLEEHMDTCLPKQSVYDAYR RKYCESLACCRPLSTANFGKIIREIFPDIKARRLGGR

GQSK KYCYSGIRRKTLVSMPPLPGLDLKGSES PEMGPEVSPAPRDELVEAACALTCDWAERILKRSFSSIVQVARYLLQQHLISARSAHAHVLKAGGL

AE EEDERAPRERSLCKSKNVVESLEGGGPKKPERPAQ PPKEQEARAGTDLPGRAERKKSVIDSSVPAASKPQVNALVARLPVLLPRAPRSLITPISGT

LKVATLPLPTRVGGPQTAVPIINMILPPVPTLSGAGPGPGPGLGPRFGPGPGLGPGPGPGLGAGLGPGLGPGLGAGPGPGLGAGLGAGLGLGPGRVPPRA

PILPRGAENREVGISSDPRPHDKGIKRTAEVPLSEASGQDPPVKEMKHETQDTTVSEAKRKRGRPRKKPGGSGERNATPEKSAAIVNSPRSPRLLWETWG

SKRENNFIGRPEGPGPGGEAERETVLVQGQQDGAVSKGERSLSSQEAKEAEDKIPPVTSKVSVIKGRIQKEALQLVKGEADAATQGNKGLKGRVLQSSLT

PEHKDPKATPP
Transcript ENSMUST00000107260
Sequence
CGTGTATCCAGGCAGATCGCGGCTGGCATAACCATTCAGAAAAAGGAAAAATAAAAGCAACGCACGAGCCCGCCGGCTGGGCACCGTGGGGCTGGGCAGG

AGCTGAGGTAGCCACAGG - UNI33209 - TTTTCCAGATTTGGGAGACTTCAAAAGGTGGGACATATAGAATGGAGATGTCAGAGATCTCTTTGGGT

ATACAAGGGCCTGATAAAGTAACAGAATAATTCTAATTTTAGAGAAGGCAA - UNI19094 - - UNI30125 - CCCTCATGCTGGGATGGCAGAA

GATAAACCTGATGCTAAGAGCCCCAAGACTGGGGCAAGGCCCCAAGGTGGTGCTGACGCTGGAGAACCTACCACCCTCCTCCAAAGGCTCCGAGGTACCA

TTTC - UNI19094 - CAAGGCCGTGCAGAACAAAGTAGAGGGAATTCTG CAAGAAGTACAGAAATTCTCGGACAACGACAAGCTGTACCTCTACCT

TCAGCTCCCATCGGGGCCCAGCGTTGGCGAGAAGAG CTCAGAGCCAAGTCTGCTCAGCAATGAGGAGTATATGTATGCCTATAGGTGGATCCGCAACCA

CCTGGAAGAGCACATGGATACCTGCCTGCCAAAGCAGAGCGTCTATGATGCCTATCG AAAGTACTGCGAGAGCCTCGCCTGTTGCCGCCCGCTCAGCAC

AGCCAACTTCGGTAAAATCATCAGAGAGATCTTCCCTGACATCAAGGCCCGAAGACTCGGTGGCCGGGGCCAGTCCAA ATATTGCTACAGTGGCATTCG

AAGGAAGACCTTGGTATCCATGCCACCATTGCCTGGACTCGACTTGAAGGGATCTGAAAGT CCAGAAATGGGCCCAGAAGTAAGCCCAGCACCTCGGGA

TGAACTGGTAGAAGCAGCCTGTGCCCTGACTTGTGACTGGGCAGAGCGGATCCTGAAGCGGTCCTTCAGTTCCATCGTCCAGGTCGCCCGCTACCTCCTG

CAGCAGCATCTCATCTCTGCCCGGTCGGCACATGCTCATGTGCTTAAGGCCGGGGGGCTTGCTG AAGAGGATGAAAGAGCCCCTCGAGAACGGTCATTA

TGTAAGTCCAAGAATGTCGTAGAAAGCCTGGAAGGGGGAGGCCCTAAGAAACCAGAGAGACCGGCCCAG CCTCCTAAAGAGCAAGAAGCCCGAGCTGGG

ACAGACCTTCCAGGGCGTGCAGAACGGAAGAAGAGTGTAATTGACAGCTCGGTTCCAGCAGCCAGTAAGCCACAAGTTAATGCTCTTGTGGCCCGACTGC

CTGTGCTGCTTCCAAGAGCACCACGATCACTTATCACACCCATTTCAGGCACTCTGAAAGTAGCTACGCTGCCTCTACCCACTAGGGTTGGAGGGCCCCA

GACAGCTGTGCCCATCATCAACATGATCTTACCACCTGTTCCTACTTTGTCAGGGGCTGGGCCTGGGCCTGGGCCTGGCCTTGGGCCTAGGTTTGGGCCA

GGGCCTGGGCTTGGGCCTGGGCCGGGGCCTGGTCTGGGGGCTGGTCTGGGGCCTGGGTTAGGGCCTGGGCTTGGAGCTGGACCAGGGCCCGGGCTTGGAG

CTGGGCTTGGGGCTGGCCTAGGGCTTGGGCCTGGGCGAGTTCCACCTAGAGCACCCATTCTGCCTCGAGGTGCAGAGAACAGGGAGGTAGGCATAAGTAG

TGATCCAAGACCTCATGACAAGGGTATCAAAAGGACAGCTGAAGTGCCTCTGAGTGAGGCCAGTGGGCAGGACCCACCAGTTAAAGAAATGAAGCACGAA

ACACAGGATACTACAGTAAGTGAAGCAAAAAGGAAGCGAGGACGCCCTCGAAAGAAGCCAGGAGGGAGTGGGGAAAGAAACGCTACTCCTGAGAAGTCTG

CAGCTATTGTGAACTCTCCCCGATCCCCAAGGCTACTCTGGGAGACATGGGGCTCAAAAAGAGAAAACAACTTCATTGGGAGACCAGAAGGACCAGGGCC

AGGGGGTGAGGCTGAGCGGGAAACAGTGCTTGTGCAAGGTCAGCAAGATGGTGCTGTTTCCAAAGGAGAAAGGAGCTTGAGTTCCCAGGAAGCCAAAGAA

GCAGAAGATAAAATTCCTCCTGTCACTTCAAAAGTGAGTGTTATCAAGGGCAGAATTCAAAAAGAGGCTCTTCAGTTGGTAAAGGGAGAGGCTGATGCTG

CAACACAGGGCAACAAAGGGTTAAAGGGTCGTGTACTTCAAAGTTCCCTAACCCCTGAGCATAAAGACCCCAAAGCAACACCCCCATGATAGACAGATAG

GTCTGTGGGGGAAGAGTGGCTATGTTCATGTGAGCTCTGCCTGCTGCCTGGCAGAGGCCCTTCACTGAGCCTCCTTCTCATCCAGCTAGTCTTCCCCCAC

AGGGAACCCAGTGGCCTGGCTTGCTTTGTGCCTCGTGGCTGCTTCAGGCCTTTCTAGCTCAGTACCATGGCTTTAATACAAACAGCAAATCTGTAATGAC

TTCCCACCTATATCCCTGTGTTCTCCTAGGAGATAGGGTAAGTAGGTTAGGGATATTCTGGCTTCTAATCATAGGGAACTTAACTCAAAACTCATTAAAG

ATAAAAGCAGTTTAT
Translation
 - UNI33209 -  - UNI19094 - - UNI30125 - MAEDKPDAKSPKTGARPQGGADAGEPTTLLQRLRGTIS - UNI19094 - SKAVQNK

VEGIL QEVQKFSDNDKLYLYLQLPSGPSVGEKS SSEPSLLSNEEYMYAYRWIRNHLEEHMDTCLPKQSVYDAYR RKYCESLACCRPLSTANFGKIIR

EIFPDIKARRLGGRGQSK KYCYSGIRRKTLVSMPPLPGLDLKGSES PEMGPEVSPAPRDELVEAACALTCDWAERILKRSFSSIVQVARYLLQQHLIS

ARSAHAHVLKAGGLAE EEDERAPRERSLCKSKNVVESLEGGGPKKPERPAQ PPKEQEARAGTDLPGRAERKKSVIDSSVPAASKPQVNALVARLPVLL

PRAPRSLITPISGTLKVATLPLPTRVGGPQTAVPIINMILPPVPTLSGAGPGPGPGLGPRFGPGPGLGPGPGPGLGAGLGPGLGPGLGAGPGPGLGAGLG

AGLGLGPGRVPPRAPILPRGAENREVGISSDPRPHDKGIKRTAEVPLSEASGQDPPVKEMKHETQDTTVSEAKRKRGRPRKKPGGSGERNATPEKSAAIV

NSPRSPRLLWETWGSKRENNFIGRPEGPGPGGEAERETVLVQGQQDGAVSKGERSLSSQEAKEAEDKIPPVTSKVSVIKGRIQKEALQLVKGEADAATQG

NKGLKGRVLQSSLTPEHKDPKATPP
Transcript ENSMUST00000029772
Sequence
CTGTAGCCCTCATGCTGGGATGGCAGAAGATAAACCTGATGCTAAGAGCCCCAAGACTGGGGCAAGGCCCCAAGGTGGTGCTGACGCTGGAGAACCTACC

ACCCTCCTCCAAAGGCTCCGAGGTACCATTTC - UNI19094 - CAAGGCCGTGCAGAACAAAGTAGAGGGAATTCTG CAAGAAGTACAGAAATTCT

CGGACAACGACAAGCTGTACCTCTACCTTCAGCTCCCATCGGGGCCCAGCGTTGGCGAGAAGAG CTCAGAGCCAAGTCTGCTCAGCAATGAGGAGTATA

TGTATGCCTATAGGTGGATCCGCAACCACCTGGAAGAGCACATGGATACCTGCCTGCCAAAGCAGAGCGTCTATGATGCCTATCG AAAGTACTGCGAGA

GCCTCGCCTGTTGCCGCCCGCTCAGCACAGCCAACTTCGGTAAAATCATCAGAGAGATCTTCCCTGACATCAAGGCCCGAAGACTCGGTGGCCGGGGCCA

GTCCAA ATATTGCTACAGTGGCATTCGAAGGAAGACCTTGGTATCCATGCCACCATTGCCTGGACTCGACTTGAAGGGATCTGAAAGT CCAGAAATGG

GCCCAGAAGTAAGCCCAGCACCTCGGGATGAACTGGTAGAAGCAGCCTGTGCCCTGACTTGTGACTGGGCAGAGCGGATCCTGAAGCGGTCCTTCAGTTC

CATCGTCCAGGTCGCCCGCTACCTCCTGCAGCAGCATCTCATCTCTGCCCGGTCGGCACATGCTCATGTGCTTAAGGCCGGGGGGCTTGCTG AAGAGGA

TGAAAGAGCCCCTCGAGAACGGTCATTATGTAAGTCCAAGAATGTCGTAGAAAGCCTGGAAGGGGGAGGCCCTAAGAAACCAGAGAGACCGGCCCAG CC

TCCTAAAGAGCAAGAAGCCCGAGCTGGGACAGACCTTCCAGGGCGTGCAGAACGGAAGAAGAGTGTAATTGACAGCTCGGTTCCAGCAGCCAGTAAGCCA

CAAGTTAATGCTCTTGTGGCCCGACTGCCTGTGCTGCTTCCAAGAGCACCACGATCACTTATCACACCCATTTCAGGCACTCTGAAAGTAGCTACGCTGC

CTCTACCCACTAGGGTTGGAGGGCCCCAGACAGCTGTGCCCATCATCAACATGATCTTACCACCTGTTCCTACTTTGTCAGGGGCTGGGCCTGGGCCTGG

GCCTGGCCTTGGGCCTAGGTTTGGGCCAGGGCCTGGGCTTGGGCCTGGGCCGGGGCCTGGTCTGGGGGCTGGTCTGGGGCCTGGGTTAGGGCCTGGGCTT

GGAGCTGGACCAGGGCCCGGGCTTGGAGCTGGGCTTGGGGCTGGCCTAGGGCTTGGGCCTGGGCGAGTTCCACCTAGAGCACCCATTCTGCCTCGAGGTG

CAGAGAACAGGGAGGTAGGCATAAGTAGTGATCCAAGACCTCATGACAAGGGTATCAAAAGGACAGCTGAAGTGCCTCTGAGTGAGGCCAGTGGGCAGGA

CCCACCAGTTAAAGAAATGAAGCACGAAACACAGGATACTACAGTAAGTGAAGCAAAAAGGAAGCGAGGACGCCCTCGAAAGAAGCCAGGAGGGAGTGGG

GAAAGAAACGCTACTCCTGAGAAGTCTGCAGCTATTGTGAACTCTCCCCGATCCCCAAGGCTACTCTGGGAGACATGGGGCTCAAAAAGAGAAAACAACT

TCATTGGGAGACCAGAAGGACCAGGGCCAGGGGGTGAGGCTGAGCGGGAAACAGTGCTTGTGCAAGGTCAGCAAGATGGTGCTGTTTCCAAAGGAGAAAG

GAGCTTGAGTTCCCAGGAAGCCAAAGAAGCAGAAGATAAAATTCCTCCTGTCACTTCAAAAGTGAGTGTTATCAAGGGCAGAATTCAAAAAGAGGCTCTT

CAGTTGGTAAAGGGAGAGGCTGATGCTGCAACACAGGGCAACAAAGGGTTAAAGGGTCGTGTACTTCAAAGTTCCCTAACCCCTGAGCATAAAGACCCCA

AAGCAACACCCCCATGATAGACAGATAGGTCTGTGGGGGAAGAGTGGCTATGTTCATGTGAGCTCTGCCTGCTGCCTGGCAGAGGCCCTTCACTGAGCCT

CCTTCTCATCCAGCTAGTCTTCCCCCACAGGGAACCCAGTGGCCTGGCTTGCTTTGTGCCTCGTGGCTGCTTCAGGCCTTTCTAGCTCAGTACCATGGCT

TTAATACAAACAGCAAATCTGTAATGACTTCCCACCTATATCCCTGTGTTCTCCTAGGAGATAGGGTAAGTAGGTTAGGGATATTCTGGCTTCTAATCAT

AGGGAACTTAACTCAAAACTCATTAAAGATAAAAGCAGTTTATCAGCTGAAGTTGCAGAATCAAGAGGCAGTCCTGGCTGCAGGTGAGGCTTGATCTGAT

TGCACACTCTGTTCTTCTGCTTCACATAATGTAAAACCATCCTTAGTTTGGACCACTTCACAGCCACCAACACTCCCAGGCTTCTGTTTGACCGTTATAT

CTAAGCAGAAAGAAAGGGTATCTATCATTGTGCCAGGAATCCTAGCAAAAGCCCAAAGATTTACCATGATTAACCAGCCAAGGTCAGTTCCACCCTTGGC

CAGCTAGTATGGCCAGGAAGATGTTTATGCAAATGTGTCTCTACACATCGTGGACCACCCTTGGGAAAGGGTGGAGTCCGCCGTCTCACAGTCCCAGGTT

CCCCAGATGGAGGCTTGGGTGGAGGATGGAATTGTTGCTGGGGAGCAGCTAACGACCGCTGGGTGCGGTTTAGCTTGCTAGGCTGGGATGAGCTGGACTG

CTGCCTGTCCCCTGAACCTTGCATCTCCCTCAGTGCAGCTCTAACTTTTATCTCATTGTAGCCTCGGAAGGACAGAGAAGGAAGCCATTCTCGTTAGTCT

CTTCATTCTTACAGGACAGCTTTCGCACCTCTGTCTCCCAGAACAAGCTCCTTTTAGGGTCTGAATCTTAAACTTTCTCCGCAGCCGTGTTTCCTACCTC

CCAACCTAGTGTCACCTTCTCAGAGGATATGAATGCCCCTCCCAAGCCATTTCATTACATTACCTTCATTCTGCAGCCACCAGATGTCATGCACTTGTCA

CATGTGTCAGGACCTAGCCAGGACTGTGGGCTTAGGCTGGATTAACAGATGCTGCGAGTCAGGGAGCACCTGCAGGAAGGATGCAGACGCTCCAGCTGTG

TCCTTGGGAACAGCAGGAAACCAGCCCATATTAATCAAGGACCTACTCCGTCCTCCCCACAGGACAGCTTCTTGTCAGGGAATCTTGGTTTTATTCCCAA

GAAATAGATTTTCTTTCAGGGAGATACCACCCATTTGTCCATTTATTTCCATGAGAACAGATTTTTTAAAAATTATAAGTAATCTTTGATATCTATAAAG

AAATATGTACTATAAATTATGAAATGCAATGAATACCTATGACCCATCATTCAATTTATACATTGAAAGTAGTTTTTTCCCCCTTGCCCGGCCTCTTCCT

AGAGGTAATCACTGTCTTTAATTTTTGGTTATTAATCATTTGTTTATATATATTGGCCATGTGTATATATATTCTTTAGGAATGTATAATTTTGTATTGC

TTGTATTTTTAGCTTTAAAAAATGTTGTCCTGTGTTCCTTGAGGTTTGCTTTTTTGCACTTACCCATTGTTTCTCCGACTCCTCTGTTGTAATTGCTATG

ACTTGTTCCTCTGCATCTGTATAATACCCCATCAAGCAACTTAGCCACTCACCTACTGAGTAACACTTGGGCTGTCGGCAGGCTTCTGTTATTATACACA

ATGCTGCTATGAACATTCTTGTATATGAGTGCCTTTGTTTTTAGTAAGATTTCTAAAGAGGTTTCTAAGATGGTCCTTTTGGTCTGTGTACCCTCTGAGC

TGGGGACTGTTGCCTCTTGTCTTACTTTATGGAAGAGTTTACATCACATAGAAATGAACTGTTCTTGAATGTTTGATAAAAACTCACCTATAAAGCCATC

TGAGCCTTATGTTTCTTTGTGGACATAATTTTGTTTTGTTTTGTTTTCAAGACAGGGTCTGTTAGGTAGCTCTGCTGCCCTGGAACTCGCTATGTAGACC

AGGCTGCCTCTGCCCCCCGACTGCTGAGACTAAAGGTATGCACCACTGTGTGCTCTTTGTAGGCATAATATTAACTACTGGTTCAAGTTACTTAATAACT

ATATATACTA
Translation
MAEDKPDAKSPKTGARPQGGADAGEPTTLLQRLRGTIS - UNI19094 - SKAVQNKVEGIL QEVQKFSDNDKLYLYLQLPSGPSVGEKS SSEPSL

LSNEEYMYAYRWIRNHLEEHMDTCLPKQSVYDAYR RKYCESLACCRPLSTANFGKIIREIFPDIKARRLGGRGQSK KYCYSGIRRKTLVSMPPLPGLD

LKGSES PEMGPEVSPAPRDELVEAACALTCDWAERILKRSFSSIVQVARYLLQQHLISARSAHAHVLKAGGLAE EEDERAPRERSLCKSKNVVESLEG

GGPKKPERPAQ PPKEQEARAGTDLPGRAERKKSVIDSSVPAASKPQVNALVARLPVLLPRAPRSLITPISGTLKVATLPLPTRVGGPQTAVPIINMILP

PVPTLSGAGPGPGPGLGPRFGPGPGLGPGPGPGLGAGLGPGLGPGLGAGPGPGLGAGLGAGLGLGPGRVPPRAPILPRGAENREVGISSDPRPHDKGIKR

TAEVPLSEASGQDPPVKEMKHETQDTTVSEAKRKRGRPRKKPGGSGERNATPEKSAAIVNSPRSPRLLWETWGSKRENNFIGRPEGPGPGGEAERETVLV

QGQQDGAVSKGERSLSSQEAKEAEDKIPPVTSKVSVIKGRIQKEALQLVKGEADAATQGNKGLKGRVLQSSLTPEHKDPKATPP

For any suggestions or comments, please send an email to unitrap@crg.es