Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000005871 (Apc)
Chromosomal location
Chr 18: 34380638 - 34479735 (+)
Description
adenomatosis polyposis coli Gene [Source:MGI Symbol;Acc:MGI:88039]
RefSeq_dna
NM_007462 
RefSeq_peptide
NP_031488.2 
UniGene
Mm.470430 Mm.384171 
MGI
MGI:88039 
Uniprot/SWISSPROT
Q61315 
Uniprot/SPTREMBL
Q8C493 Q8C9I9 Q3UQT2 B2RUG9 Q8BNP7 Q8BRD8 
Human Ortholog
ENSG00000134982 (APC)
Omim 135290 - DESMOID DISEASE, HEREDITARY  155255 - MEDULLOBLASTOMA  175100 - ADENOMATOUS POLYPOSIS OF THE COLON  276300 - MISMATCH REPAIR CANCER SYNDROME  
UniTrap UNI2975
Vector Insertion
Chr 18: 34380637 - 34380931
Public Clones AB0046 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18214
Vector Insertion
Chr 18: 34380931 - 34420658
Public Clones (sanger) E055B10 (ggtc) E125A02 (ggtc) IST14648A5 (tigm) IST11644C12 (tigm)
IST14540B9 (tigm) IST11272F11 (tigm) IST14962H11 (tigm) IST14264D9 (tigm)
IST14648A4 (tigm)
Private Clones OST427365 (lexicon) OST427118 (lexicon) OST426730 (lexicon) OST382068 (lexicon)
OST360255 (lexicon) OST301926 (lexicon) OST291741 (lexicon) OST166517 (lexicon)
OST166477 (lexicon) OST52435 (lexicon) OST33788 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22999
Vector Insertion
Chr 18: 34428034 - 34428709
Public Clones not available
Private Clones OST279266 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7476
Vector Insertion
Chr 18: 34436332 - 34438922
Public Clones RRN319 (baygenomics) RRR800 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10387
Vector Insertion
Chr 18: 34439007 - 34449009
Public Clones XA018 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36424
Vector Insertion
Chr 18: 34449845 - 34455684
Public Clones (sanger) IST12622E6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33575
Vector Insertion
Chr 18: 34466034 - 34470346
Public Clones IST11575B8 (tigm) IST11177C12 (tigm) IST13646C10 (tigm) IST10099E4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000066133
Sequence
GAGCTTCGGGCGAAGGCCCGGGAGCAGCGGACCGAGGCTGGCGCGATGCTGTTCCCGGGGAGCGCAGTCGGCTACCGTTGAGGAAGGTGGAGTGAGGAGT

GGCCCTTCCAGCGCCCCCTATGTACGCCTTCCTGCGCTCGGGGCCGGTCGCCGCGTTGCCCGCCTCCGTACCGCCCGTGACTCTCGGGGCCCGGAGCTCC

GGCGGCGGCCGGGGTCGAGTCCCGGGGGAGGGGAGGCGCCCGGGCGGCGCCCGAGCTTGCGGCCGCGGAGCGAGCGTCTGGCAG - UNI2975 - - U

NI18214 - GTCCAAGGGTAGCCAAGGATGGCTGCAGCTTCATATGATCAGTTGTTAAAGCAAGTTGAGGCACTGAAGATGGAGAACTCAAATCTTCGA

CAAGAGCTAGAAGATAATTCCAATCATCTTACAAAACTGGAAACTGAGGCATCTAATATGAAG GAAGTACTTAAGCAGCTACAGGGAAGTATTGAAGAT

GAGACTATGACTTCTGGACAGATTGACTTACTAGAGCGTCTTAAAG - UNI22999 - AATTTAACTTAGATAGTAATTTCCCCGGAGTGAAACTACG

CTCAAAAATGTCCCTTCGCTCCTACGGAAGTCGGGAAGGATCTGTATCCAGCCGTTCAGGAGAATGCAGTCCTGTCCCCATGGGGTCATTCCCAAGAAGA

ACATTTGTAAATGGAAGCAGAGAGAGTACTGGGTATCTAGAAGAGCTTGAAAAAGAAAG ATCATTACTCCTTGCTGATCTTGACAAAGAAGAGAAGGAA

AAGGACTGGTATTATGCTCAACTTCAGAACCTCACAAAAAGAATAGATAGCCTGCCTTTAACTGAAAAT TTTTCCTTACAGACAGACATGACAAGACGG

CAGCTGGAGTATGAAGCAAGGCAGATCAGGGCTGCAATGGAGGAGCAGCTTGGCACCTGCCAGGACATGGAGAAGCGTGCACAG - UNI7476 - CGA

AGAATAGCCAGGATCCAGCAAATAGAAAAGGACATACTGCGCGTGCGCCAGCTTTTACAGTCCCAGGCGGCGGAAGCGGAG - UNI10387 - AGGTC

ATCTCAGAGCAGGCATGATGCTGCCTCCCATGAAGCTGGCCGGCAGCACGAAGGCCACGGAGTGGCAGAAAGCAACACCGCAGCCTCCAGTAGTGGTCAG

 AGACACTTTCTGAACGTGTTGGAACATTTCCTGCTCGGATCGCATGTGCGTGGCCTTCAACTGCTGCCGTGCGCATTCTGGAGAGAGTTTACTTCCGAG

GGGCTGACCCTGGTGTTGCATGTTAGCACACAGTTCTGCTCTCCTTAA
Translation
 - UNI2975 - - UNI18214 - MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMK EVLKQLQGSIEDETMTSGQIDLLERLKE

 - UNI22999 - EFNLDSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPRRTFVNGSRESTGYLEELEKER RSLLLADLDKEEKEKDWY

YAQLQNLTKRIDSLPLTEN FSLQTDMTRRQLEYEARQIRAAMEEQLGTCQDMEKRAQ - UNI7476 - RRIARIQQIEKDILRVRQLLQSQAAEAE 

- UNI10387 - RSSQSRHDAASHEAGRQHEGHGVAESNTAASSSGQ RHFLNVLEHFLLGSHVRGLQLLPCAFWREFTSEGLTLVLHVSTQFCSP
Transcript ENSMUST00000115781
Sequence
ACCTTGGGGGAGCTTCGGGCGAAGGCCCGGGAGCAGCGGACCGAGGCTGGCGCGATGCTGTTCCCGGGGAGCGCAGTCGGCTACCGTTGAGGAAGGTGGA

GTGAGGAGTGGCCCTTCCAGCGCCCCCTATGTACGCCTTCCTGCGCTCGGGGCCGGTCGCCGCGTTGCCCGCCTCCGTACCGCCCGTGACTCTCGGGGCC

CGGAGCTCCGGCGGCGGCCGGGGTCGAGTCCCGGGGGAGGGGAGGCGCCCGGGCGGCGCCCGAGCTTGCGGCCGCGGAGCGAGCGTCTGGCAG - UNI2

975 - - UNI18214 - GTCCAAGGGTAGCCAAGGATGGCTGCAGCTTCATATGATCAGTTGTTAAAGCAAGTTGAGGCACTGAAGATGGAGAACTCA

AATCTTCGACAAGAGCTAGAAGATAATTCCAATCATCTTACAAAACTGGAAACTGAGGCATCTAATATGAAG GAAGTACTTAAGCAGCTACAGGGAAGT

ATTGAAGATGAGACTATGACTTCTGGACAGATTGACTTACTAGAGCGTCTTAAAG - UNI22999 - AATTTAACTTAGATAGTAATTTCCCCGGAGT

GAAACTACGCTCAAAAATGTCCCTTCGCTCCTACGGAAGTCGGGAAGGATCTGTATCCAGCCGTTCAGGAGAATGCAGTCCTGTCCCCATGGGGTCATTC

CCAAGAAGAACATTTGTAAATGGAAGCAGAGAGAGTACTGGGTATCTAGAAGAGCTTGAAAAAGAAAG ATCATTACTCCTTGCTGATCTTGACAAAGAA

GAGAAGGAAAAGGACTGGTATTATGCTCAACTTCAGAACCTCACAAAAAGAATAGATAGCCTGCCTTTAACTGAAAAT TTTTCCTTACAGACAGACATG

ACAAGACGGCAGCTGGAGTATGAAGCAAGGCAGATCAGGGCTGCAATGGAGGAGCAGCTTGGCACCTGCCAGGACATGGAGAAGCGTGCACAG - UNI7

476 - CGAAGAATAGCCAGGATCCAGCAAATAGAAAAGGACATACTGCGCGTGCGCCAGCTTTTACAGTCCCAGGCGGCGGAAGCGGAG - UNI1038

7 - AGG AGTCCAGCTACACGTGTGGATCACGAAACAGCCAGTGTTTTGAGTTCTAGCGGCACGCACTCTGCTCCTCGAAGGTTGACAAGTCATCTGGG

GACAAAG GTGGAAATGGTGTATTCCTTGTTGTCAATGCTTGGTACTCATGATAAGGACGATATGTCACGAACTTTGCTAGCTATGTCCAGCTCCCAAGA

CAGCTGTATATCCATGCGGCAGTCTGGATGTCTTCCTCTCCTCATCCAGCTTTTACATGGCAATGACAAAGACTCTGTATTGTTGGGAAATTCCCGGGGC

AGTAAAGAGGCTCGGGCCAGGGCCAGTGCAGCACTCCACAACATCATTCACTCACAGCCTGATGACAAGAGAGGCAGGCGTGAAATCCGAGTCCTTCATC

TTTTGGAACAGATACGAGCTTACTGTGAAACCTGTTGGGAGTGGCAGGAAGCCCACGAACAAGGCATGGACCAGGACAAAAACCCAA TGCCAGCTCCTG

TTGAGCATCAGATCTGTCCTGCTGTGTGTGTTCTAATGAAGCTTTCATTTGATGAAGAGCATAGGCATGCAATGAATGAACTTG GGGGACTGCAGGCCA

TTGCAGAGTTATTGCAGGTGGACTGTGAGATGTATGGGCTTACTAATGACCACTACAGTGTTACTTTAAGACGGTATGCTGGAATGGCTTTGACAAACTT

GACCTTTGGAGATGTTGCCAACAAG GCTACGCTGTGTTCTATGAAAGGCTGCATGAGAGCACTTGTGGCCCAGTTAAAATCTGAGAGTGAAGACTTACA

GCAG GTTATTGCAAGTGTTTTGAGGAATTTGTCTTGGCGAGCAGATGTAAATAGCAAAAAGACGTTGAGAGAAGTTGGAAGTGTGAAAGCATTGATGGA

ATGTGCTTTGGAAGTTAAAAAG - UNI33575 - GAATCAACCCTCAAAAGCGTTTTGAGTGCCTTATGGAACCTGTCTGCACACTGCACTGAGAATA

AGGCTGACATCTGTGCTGTGGATGGAGCACTGGCATTTCTGGTTGGCACCCTCACTTACCGGAGCCAGACAAATACTTTAGCCATTATTGAAAGTGGAGG

TGGGATATTACGGAATGTGTCCAGCTTGATAGCTACAAACGAAGACCACAG GCAAATCCTAAGAGAGAACAATTGCCTACAAACTTTATTACAGCACTT

GAAATCTCACAGCTTGACAATAGTCAGTAATGCATGTGGAACTTTGTGGAATCTCTCAGCAAGAAATCCTAAAGACCAGGAAGCCTTGTGGGACATGGGG

GCAGTGAGCATGCTCAAGAACCTCATTCATTCCAAGCACAAAATGATTGCCATGGGAAGTGCAGCAGCTTTAAGGAATCTCATGGCAAACAGACCTGCAA

AGTATAAGGATGCCAATATCATGTCTCCCGGCTCAAGTCTGCCATCCCTTCACGTTAGGAAACAGAAAGCTCTAGAAGCTGAGCTAGATGCTCAGCATTT

ATCAGAAACCTTCGACAACATTGACAACCTAAGTCCCAAGGCCTCTCACCGGAGTAAGCAGAGACACAAGCAGAATCTTTATGGTGACTATGCTTTTGAC

GCCAATCGACATGATGATAGTAGGTCAGACAATTTCAATACTGGAAACATGACTGTTCTTTCACCATATTTAAATACTACGGTATTGCCCAGCTCTTCTT

CCTCAAGGGGAAGTTTAGACAGTTCTCGTTCTGAGAAAGACAGAAGTTTGGAGAGAGAGCGAGGTATTGGCCTCAGTGCTTACCATCCAACAACAGAAAA

TGCAGGAACCTCATCAAAACGAGGTCTGCAGATCACTACCACTGCAGCCCAGATAGCCAAAGTTATGGAAGAAGTATCAGCCATTCATACCTCCCAGGAC

GACAGAAGTTCTGCTTCTACCACCGAGTTCCATTGTGTGGCAGACGACAGGAGTGCGGCACGAAGAAGCTCTGCCTCCCACACACACTCAAACACATACA

ACTTCACTAAGTCGGAAAATTCAAATAGGACATGCTCTATGCCTTATGCCAAAGTGGAATATAAACGATCTTCAAATGACAGTTTAAATAGTGTCACTAG

TAGTGATGGATATGGTAAAAGAGGCCAAATGAAACCCTCAGTTGAATCCTATTCTGAAGATGATGAAAGTAAATTTTGCAGTTATGGTCAGTATCCAGCT

GACCTAGCCCATAAGATACACAGTGCAAATCATATGGATGATAATGATGGAGAACTGGATACACCAATAAATTACAGTCTTAAATATTCAGATGAGCAGT

TGAACTCAGGAAGGCAGAGTCCCTCACAGAATGAAAGGTGGGCAAGACCAAAGCATGTGATAGAAGATGAAATAAAGCAAAACGAGCAAAGACAAGCAAG

AAGCCAGAACACCAGTTATCCTGTCTATTCTGAGAATACCGATGACAAACACCTCAAATTCCAACCACATTTTGGACAACAAGAATGTGTTTCCCCATAT

AGGTCAAGGGGAACCAGTGGTTCAGAAACAAATCGAATGGGTTCTAGTCATGCAATTAATCAAAATGTAAACCAGTCTCTGTGTCAGGAAGATGATTATG

AAGATGATAAACCTACCAACTACAGTGAACGTTATTCTGAGGAAGAACAACATGAAGAAGAAGAAGAGAGACCGACAAATTATAGCATAAAATATAATGA

AGAGAAACATCATGTGGATCAGCCTATTGATTATAGTTTAAAATATGCCACTGACATTTCTTCCTCACAAAAACCATCATTTTCATTCTCAAAGAATTCA

TCAGCACAAAGCACTAAACCTGAACATCTCTCTCCAAGCAGCGAGAATACAGCTGTACCTCCATCTAATGCCAAAAGGCAGAATCAGCTGCGTCCAAGTT

CAGCACAAAGAAATGGCCAGACTCAAAAAGGCACTACTTGCAAAGTCCCCTCCATCAACCAAGAAACAATACAGACTTACTGCGTAGAAGACACCCCAAT

ATGTTTTTCAAGGTGCAGTTCATTATCATCACTGTCATCAGCTGACGATGAAATAGGATGTGATCAGACAACACAGGAAGCAGATTCTGCTAATACTCTG

CAGACAGCAGAAGTAAAAGAGAATGATGTAACTCGGTCAGCTGAAGATCCTGCAACTGAAGTTCCAGCAGTGTCCCAGAATGCTAGAGCCAAACCCAGCC

GACTCCAGGCTTCTGGCTTATCTTCAGAATCAACCAGGCATAATAAAGCTGTTGAGTTTTCTTCAGGAGCCAAGTCTCCCTCCAAAAGTGGTGCTCAGAC

ACCCAAAAGTCCCCCAGAACACTATGTCCAGGAGACTCCGCTCGTATTCAGCAGGTGTACTTCTGTCAGCTCCCTTGACAGTTTTGAGAGTCGCTCCATT

GCCAGCTCTGTTCAGAGTGAGCCATGTAGTGGAATGGTGAGTGGCATCATAAGCCCCAGTGACCTTCCAGATAGTCCTGGGCAGACCATGCCACCAAGCA

GAAGCAAAACCCCTCCACCTCCTCCACAGACAGTGCAGGCCAAGAGAGAGGTGCCAAAAAGTAAAGTCCCTGCTGCTGAGAAGAGAGAGAGTGGGCCTAA

GCAGACTGCTGTAAATGCTGCCGTGCAGAGGGTGCAGGTCCTTCCAGACGTGGATACTTTGTTACACTTCGCCACAGAAAGTACTCCAGACGGGTTTTCT

TGTTCCTCCAGCCTAAGTGCTCTGAGCCTGGATGAGCCATTTATACAGAAAGATGTAGAATTAAGAATCATGCCTCCAGTTCAGGAAAACGACAATGGGA

ATGAAACTGAATCAGAACAGCCTGAGGAATCAAATGAAAACCAGGATAAAGAGGTAGAAAAGCCTGACTCTGAAAAAGACTTATTAGATGATTCTGATGA

CGATGATATTGAAATATTAGAAGAATGTATTATTTCAGCCATGCCAACAAAGTCATCACGCAAAGCCAAAAAACTAGCCCAGACTGCTTCAAAATTACCT

CCACCTGTGGCAAGGAAACCAAGTCAGCTACCTGTGTATAAACTTCTGCCAGCACAGAATAGGCTGCAGGCACAAAAACATGTTAGCTTTACACCAGGGG

ATGATGTGCCCCGGGTGTACTGTGTAGAAGGGACACCTATAAACTTTTCCACAGCAACGTCTCTAAGTGATCTGACAATAGAGTCCCCTCCAAATGAATT

GGCTACTGGAGATGGGGTCAGAGCGGGTATACAGTCAGGTGAATTTGAAAAACGAGATACCATTCCTACAGAAGGCAGAAGTACAGATGATGCTCAGCGA

GGAAAAATCTCATCTATAGTTACACCAGACCTGGATGACAACAAAGCAGAGGAAGGAGATATTCTTGCAGAATGTATCAATTCTGCTATGCCCAAAGGAA

AAAGCCACAAGCCTTTCCGAGTGAAAAAGATAATGGACCAAGTCCAACAAGCATCCTCGACTTCATCTGGAGCTAACAAAAATCAAGTAGACACTAAGAA

AAAGAAGCCTACTTCACCAGTAAAGCCCATGCCACAAAATACTGAATATAGAACGCGTGTGAGAAAGAATACAGACTCAAAAGTTAATGTAAATACTGAA

GAAACTTTCTCAGACAACAAAGACTCAAAGAAACCAAGCTTACAAACCAATGCCAAGGCCTTCAATGAAAAGCTACCTAACAATGAAGACAGAGTGCGGG

GGAGCTTCGCCTTGGACTCACCGCATCACTACACCCCTATTGAGGGGACGCCGTACTGCTTTTCCCGAAATGACTCCTTGAGTTCTCTGGATTTTGATGA

TGACGATGTTGACCTTTCCAGGGAAAAGGCCGAGTTAAGAAAGGGCAAAGAAAGCAAGGATTCCGAAGCCAAAGTTACCTGCCGCCCAGAACCAAACTCA

AGCCAGCAGGCAGCTAGTAAGTCACAAGCCAGTATAAAACATCCAGCAAACAGAGCACAGTCCAAACCAGTGCTGCAGAAACAGCCCACTTTCCCCCAGT

CCTCCAAAGACGGACCAGATAGAGGGGCAGCAACTGACGAAAAACTGCAGAATTTTGCTATTGAAAATACTCCAGTTTGCTTTTCTCGAAATTCCTCTCT

GAGTTCCCTTAGTGACATTGACCAGGAAAACAACAATAACAAAGAAAGTGAACCAATCAAAGAAGCTGAACCTGCCAACTCACAAGGAGAGCCCAGTAAG

CCTCAGGCATCCGGGTATGCTCCCAAGTCCTTCCACGTCGAAGACACCCCTGTCTGTTTCTCAAGAAACAGCTCTCTCAGTTCTCTTAGCATTGACTCTG

AGGACGACCTGTTACAGGAGTGTATAAGTTCTGCCATGCCAAAAAAGAAAAGGCCTTCAAGACTCAAGAGTGAGAGCGAAAAGCAGAGCCCTAGAAAAGT

GGGTGGCATATTAGCTGAAGACCTGACGCTTGATTTGAAAGATCTACAGAGGCCAGATTCAGAACACGCTTTCTCCCCCGACTCAGAAAATTTTGACTGG

AAAGCTATTCAGGAAGGCGCAAACTCCATAGTAAGTAGTTTGCACCAAGCTGCTGCAGCCGCCGCGTGCTTATCTAGACAAGCGTCATCCGACTCAGATT

CCATTCTGTCACTAAAGTCCGGCATTTCTCTGGGATCGCCTTTTCATCTTACACCTGATCAAGAGGAAAAGCCATTCACAAGCAATAAAGGCCCAAGAAT

TCTCAAACCTGGAGAGAAAAGCACATTAGAAGCAAAAAAAATAGAATCTGAAAACAAAGGAATCAAAGGCGGGAAAAAGGTTTATAAAAGCTTGATTACG

GGAAAGATTCGCTCCAATTCAGAAATTTCCAGCCAAATGAAACAACCCCTCCCGACAAACATGCCTTCAATCTCAAGAGGCAGGACGATGATTCACATCC

CAGGGCTTCGGAATAGCTCCTCTAGTACAAGCCCTGTCTCTAAGAAAGGCCCACCCCTCAAGACTCCAGCCTCTAAAAGCCCCAGTGAAGGGCCGGGAGC

TACCACTTCTCCTCGAGGAACTAAGCCAGCAGGAAAGTCAGAGCTTAGCCCTATCACCAGGCAAACTTCCCAAATCAGTGGGTCAAATAAGGGGTCTTCT

AGATCAGGATCTAGAGACTCCACTCCCTCAAGACCTACACAGCAACCATTAAGTAGGCCAATGCAGTCTCCAGGGCGAAACTCAATTTCCCCTGGTAGAA

ATGGAATAAGCCCTCCTAACAAACTGTCTCAGCTGCCCAGAACATCATCTCCCAGTACTGCTTCAACTAAGTCCTCCGGTTCTGGGAAAATGTCATATAC

ATCCCCAGGTAGACAGCTGAGCCAACAAAATCTTACCAAACAAGCAAGTTTATCCAAGAATGCCAGCAGTATCCCCAGAAGTGAGTCGGCATCTAAAGGA

CTGAATCAGATGAGTAACGGCAATGGGTCAAATAAAAAGGTAGAACTTTCTAGAATGTCTTCAACTAAATCAAGTGGAAGTGAATCAGACAGATCAGAAA

GGCCTGCATTAGTACGCCAGTCTACTTTCATCAAAGAAGCCCCAAGCCCAACCCTGAGGAGGAAACTGGAGGAATCTGCCTCATTTGAATCCCTTTCTCC

ATCTTCTAGACCAGATTCTCCCACCAGGTCGCAGGCACAGACCCCAGTTTTAAGCCCTTCCCTTCCTGATATGTCTCTGTCCACACATCCATCTGTTCAG

GCAGGTGGGTGGCGAAAGCTCCCGCCTAATCTCAGCCCCACTATCGAGTATAATGACGGAAGGCCCACAAAACGGCATGATATTGCACGCTCCCATTCTG

AAAGTCCTTCCAGACTACCAATCAACCGGGCGGGAACCTGGAAGCGTGAACACAGCAAACATTCCTCGTCCCTTCCTCGAGTGAGTACTTGGAGAAGAAC

TGGAAGCTCATCTTCTATTCTTTCTGCTTCATCAGAGTCCAGTGAAAAAGCAAAAAGTGAGGATGAAAGGCATGTGAGCTCCATGCCAGCACCCAGACAG

ATGAAGGAAAACCAGGTGCCCACCAAAGGAACATGGAGGAAAATCAAGGAAAGTGACATTTCTCCCACAGGCATGGCTTCTCAGAGCGCTTCCTCAGGTG

CTGCCAGTGGTGCTGAATCCAAGCCTCTGATCTATCAGATGGCACCTCCTGTCTCTAAAACAGAGGATGTTTGGGTGAGAATTGAGGACTGCCCCATTAA

CAACCCTAGATCTGGACGGTCCCCCACAGGCAACACCCCCCCAGTGATTGACAGTGTTTCAGAGAAGGGAAGTTCAAGCATTAAAGATTCAAAAGACACC

CATGGGAAACAGAGTGTGGGCAGTGGCAGTCCTGTGCAAACCGTGGGTCTGGAAACCCGCCTCAACTCCTTTGTTCAGGTAGAGGCCCCAGAACAGAAAG

GAACTGAGGCAAAACCAGGACAGAGTAACCCAGTCTCTATAGCAGAGACTGCTGAGACGTGTATAGCAGAGCGTACCCCTTTCAGTTCCAGTAGCTCCAG

CAAGCACAGCTCACCTAGCGGGACTGTTGCTGCCAGAGTGACACCTTTTAATTACAACCCTAGCCCTAGGAAGAGCAGCGCAGACAGCACTTCAGCCCGG

CCGTCTCAGATCCCTACGCCAGTGAGCACCAACACGAAGAAGAGAGATTCGAAGACTGACAGCACAGAATCCAGTGGAGCCCAAAGTCCTAAACGCCATT

CCGGGTCTTACCTCGTGACGTCTGTTTAAAAGAGCTAGAAGGACAAACGTAGAAAAGCTGGTGTTAATCACTACTGCTGTATAGAGACTTTATTTCAAAG

AAAACTTTAAAGGTTGAAAATTTTTGTAAATAGGTTTGATTCTTGTTAGAGGGGTTTTGTTCTGGAAACCATATTTGATAGTACACTTTGTCCTCACTGG

TCATTTTGGGAGGCACTCTTATTAGGTAGGAAAAAATGGTAAAGCCAAGTATATTTGTACAGTGTGTTTTACATGTATTTAAGTAGCATCCATCCCATTG

TCCTTTAATTATCACCTGTCTTAAAAATAACACTACAGATAGAAACTATATGATATATTGCTGTCATCAATCACTTTTAGATTATAAATTAAACTTACAT

CAGGGAGAAATTGGTATTTATGCAAAAAAAATTAGTCCTTGTGAATCCATCTAATGTCATAATTAATCATGTGGCTGTGAAATTCACAGTAATGTGGTTC

CCCATGAATATGTTTACCCAGCCTGCTTTGCTTTACTGCATGAATGAAGCTGACGGTTCAATTTCAGAAGTAACAATTAATGATTCTGTGATCACATGGT

GTGCAGAGAGATAGCTACAGTGTAACGATTCACACTATTTTGTGCTCAAATCTGTGTAACTGTAAAGCATTGAATGAAACTATTTTAACTGAACTAGATT

TTATCAAAAGTAGGTAGAATTTTTGCTATGCTGTAACTGTTGTATATTCTGGTATTTGAGGTGAGTTGGCTGCTCTTTTATTAATGAGACACGAATTGTG

TCTCAAACTAAATGAACATTTCAGAATAAATTATTGCTGTATGTAAACTATTACTGAAATTGGTATTTGTTTGAGGGTCTTATTTCACATTTGTATTAAT

AACTGTCAAAAGGGCCTCTTTTAAAAGCTAAATGTAATTTTTTTTCTTCAGATTCTATGCATTAAGAGTAAAATTTCCTCTTGCTGTAATAAAGACAATT

GAAGAAGATTGTTGACACTTAACCATTCCTAAAATTTATTTTTATGTAATTAGCACCTCTCAATGCTTGGTATTTTTCCACTTTTTTTCTTACTCCTTGG

GGGTTTGATTAAAACAAATGCCTATAATAGCACAAGACTAGGCACTGGACATAAGGGCCCACATAGAATATCTCCTTTTCCTTAATAGAATCCATACTTG

AAAACCATTGATTCTTGACAGTTACCAGTTTTGTCTTTCAGGCTTTCCAGTGCAACTGTCTTACCCCGTCATCTTCTCCGTATTGATACTGGGTCTGAAA

TAAATGCCTACTACCACTCTGTATAGTAAGGCAGATTTTTTTTTGCAATCAGGCATAATCAGTATTTTCTCATACTCAAAAAATACAAGTCAGTGAAACA

TCAGAGATATGTAATGCTGTTATGATAATATTTCAAGAAAGATTCAAAAGTGGGCCAGGTCAGTAGGTAAAGGTGATGCCTCAAAGCCTGAAGGCCCAGT

TCACATCACAGGATGCACATGGCAGAAGG
Translation
 - UNI2975 - - UNI18214 - MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMK EVLKQLQGSIEDETMTSGQIDLLERLKE

 - UNI22999 - EFNLDSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPRRTFVNGSRESTGYLEELEKER RSLLLADLDKEEKEKDWY

YAQLQNLTKRIDSLPLTEN FSLQTDMTRRQLEYEARQIRAAMEEQLGTCQDMEKRAQ - UNI7476 - RRIARIQQIEKDILRVRQLLQSQAAEAE 

- UNI10387 - R SPATRVDHETASVLSSSGTHSAPRRLTSHLGTK VEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLLHG

NDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETCWEWQEAHEQGMDQDKNPM MPAPVEHQICPAVCVLMKLSFDE

EHRHAMNELG GGLQAIAELLQVDCEMYGLTNDHYSVTLRRYAGMALTNLTFGDVANK ATLCSMKGCMRALVAQLKSESEDLQQ VIASVLRNLSWRAD

VNSKKTLREVGSVKALMECALEVKK - UNI33575 - ESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNV

SSLIATNEDHR RQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYKDA

NIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLSPKASHRSKQRHKQNLYGDYAFDANRHDDSRSDNFNTGNMTVLSPYLNTTVLPSSSSSRGS

LDSSRSEKDRSLERERGIGLSAYHPTTENAGTSSKRGLQITTTAAQIAKVMEEVSAIHTSQDDRSSASTTEFHCVADDRSAARRSSASHTHSNTYNFTKS

ENSNRTCSMPYAKVEYKRSSNDSLNSVTSSDGYGKRGQMKPSVESYSEDDESKFCSYGQYPADLAHKIHSANHMDDNDGELDTPINYSLKYSDEQLNSGR

QSPSQNERWARPKHVIEDEIKQNEQRQARSQNTSYPVYSENTDDKHLKFQPHFGQQECVSPYRSRGTSGSETNRMGSSHAINQNVNQSLCQEDDYEDDKP

TNYSERYSEEEQHEEEEERPTNYSIKYNEEKHHVDQPIDYSLKYATDISSSQKPSFSFSKNSSAQSTKPEHLSPSSENTAVPPSNAKRQNQLRPSSAQRN

GQTQKGTTCKVPSINQETIQTYCVEDTPICFSRCSSLSSLSSADDEIGCDQTTQEADSANTLQTAEVKENDVTRSAEDPATEVPAVSQNARAKPSRLQAS

GLSSESTRHNKAVEFSSGAKSPSKSGAQTPKSPPEHYVQETPLVFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTP

PPPPQTVQAKREVPKSKVPAAEKRESGPKQTAVNAAVQRVQVLPDVDTLLHFATESTPDGFSCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETES

EQPEESNENQDKEVEKPDSEKDLLDDSDDDDIEILEECIISAMPTKSSRKAKKLAQTASKLPPPVARKPSQLPVYKLLPAQNRLQAQKHVSFTPGDDVPR

VYCVEGTPINFSTATSLSDLTIESPPNELATGDGVRAGIQSGEFEKRDTIPTEGRSTDDAQRGKISSIVTPDLDDNKAEEGDILAECINSAMPKGKSHKP

FRVKKIMDQVQQASSTSSGANKNQVDTKKKKPTSPVKPMPQNTEYRTRVRKNTDSKVNVNTEETFSDNKDSKKPSLQTNAKAFNEKLPNNEDRVRGSFAL

DSPHHYTPIEGTPYCFSRNDSLSSLDFDDDDVDLSREKAELRKGKESKDSEAKVTCRPEPNSSQQAASKSQASIKHPANRAQSKPVLQKQPTFPQSSKDG

PDRGAATDEKLQNFAIENTPVCFSRNSSLSSLSDIDQENNNNKESEPIKEAEPANSQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLL

QECISSAMPKKKRPSRLKSESEKQSPRKVGGILAEDLTLDLKDLQRPDSEHAFSPDSENFDWKAIQEGANSIVSSLHQAAAAAACLSRQASSDSDSILSL

KSGISLGSPFHLTPDQEEKPFTSNKGPRILKPGEKSTLEAKKIESENKGIKGGKKVYKSLITGKIRSNSEISSQMKQPLPTNMPSISRGRTMIHIPGLRN

SSSSTSPVSKKGPPLKTPASKSPSEGPGATTSPRGTKPAGKSELSPITRQTSQISGSNKGSSRSGSRDSTPSRPTQQPLSRPMQSPGRNSISPGRNGISP

PNKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQLSQQNLTKQASLSKNASSIPRSESASKGLNQMSNGNGSNKKVELSRMSSTKSSGSESDRSERPALV

RQSTFIKEAPSPTLRRKLEESASFESLSPSSRPDSPTRSQAQTPVLSPSLPDMSLSTHPSVQAGGWRKLPPNLSPTIEYNDGRPTKRHDIARSHSESPSR

LPINRAGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSESSEKAKSEDERHVSSMPAPRQMKENQVPTKGTWRKIKESDISPTGMASQSASSGAASGA

ESKPLIYQMAPPVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDSVSEKGSSSIKDSKDTHGKQSVGSGSPVQTVGLETRLNSFVQVEAPEQKGTEAK

PGQSNPVSIAETAETCIAERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVSTNTKKRDSKTDSTESSGAQSPKRHSGSYL

VTSV
Transcript ENSMUST00000079362
Sequence
ACCTTGGGGGAGCTTCGGGCGAAGGCCCGGGAGCAGCGGACCGAGGCTGGCGCGATGCTGTTCCCGGGGAGCGCAGTCGGCTACCGTTGAGGAAGGTGGA

GTGAGGAGTGGCCCTTCCAGCGCCCCCTATGTACGCCTTCCTGCGCTCGGGGCCGGTCGCCGCGTTGCCCGCCTCCGTACCGCCCGTGACTCTCGGGGCC

CGGAGCTCCGGCGGCGGCCGGGGTCGAGTCCCGGGGGAGGGGAGGCGCCCGGGCGGCGCCCGAGCTTGCGGCCGCGGAGCGAGCGTCTGGCAG - UNI2

975 - - UNI18214 - GTCCAAGGGTAGCCAAGGATGGCTGCAGCTTCATATGATCAGTTGTTAAAGCAAGTTGAGGCACTGAAGATGGAGAACTCA

AATCTTCGACAAGAGCTAGAAGATAATTCCAATCATCTTACAAAACTGGAAACTGAGGCATCTAATATGAAG GAAGTACTTAAGCAGCTACAGGGAAGT

ATTGAAGATGAGACTATGACTTCTGGACAGATTGACTTACTAGAGCGTCTTAAAG - UNI22999 - AATTTAACTTAGATAGTAATTTCCCCGGAGT

GAAACTACGCTCAAAAATGTCCCTTCGCTCCTACGGAAGTCGGGAAGGATCTGTATCCAGCCGTTCAGGAGAATGCAGTCCTGTCCCCATGGGGTCATTC

CCAAGAAGAACATTTGTAAATGGAAGCAGAGAGAGTACTGGGTATCTAGAAGAGCTTGAAAAAGAAAG ATCATTACTCCTTGCTGATCTTGACAAAGAA

GAGAAGGAAAAGGACTGGTATTATGCTCAACTTCAGAACCTCACAAAAAGAATAGATAGCCTGCCTTTAACTGAAAAT TTTTCCTTACAGACAGACATG

ACAAGACGGCAGCTGGAGTATGAAGCAAGGCAGATCAGGGCTGCAATGGAGGAGCAGCTTGGCACCTGCCAGGACATGGAGAAGCGTGCACAG - UNI7

476 - CGAAGAATAGCCAGGATCCAGCAAATAGAAAAGGACATACTGCGCGTGCGCCAGCTTTTACAGTCCCAGGCGGCGGAAGCGGAG - UNI1038

7 - AGGTCATCTCAGAGCAGGCATGATGCTGCCTCCCATGAAGCTGGCCGGCAGCACGAAGGCCACGGAGTGGCAGAAAGCAACACCGCAGCCTCCAGT

AGTGGTCAG AGTCCAGCTACACGTGTGGATCACGAAACAGCCAGTGTTTTGAGTTCTAGCGGCACGCACTCTGCTCCTCGAAGGTTGACAAGTCATCTG

GGGACAAAG GTGGAAATGGTGTATTCCTTGTTGTCAATGCTTGGTACTCATGATAAGGACGATATGTCACGAACTTTGCTAGCTATGTCCAGCTCCCAA

GACAGCTGTATATCCATGCGGCAGTCTGGATGTCTTCCTCTCCTCATCCAGCTTTTACATGGCAATGACAAAGACTCTGTATTGTTGGGAAATTCCCGGG

GCAGTAAAGAGGCTCGGGCCAGGGCCAGTGCAGCACTCCACAACATCATTCACTCACAGCCTGATGACAAGAGAGGCAGGCGTGAAATCCGAGTCCTTCA

TCTTTTGGAACAGATACGAGCTTACTGTGAAACCTGTTGGGAGTGGCAGGAAGCCCACGAACAAGGCATGGACCAGGACAAAAACCCAA TGCCAGCTCC

TGTTGAGCATCAGATCTGTCCTGCTGTGTGTGTTCTAATGAAGCTTTCATTTGATGAAGAGCATAGGCATGCAATGAATGAACTTG GGGGACTGCAGGC

CATTGCAGAGTTATTGCAGGTGGACTGTGAGATGTATGGGCTTACTAATGACCACTACAGTGTTACTTTAAGACGGTATGCTGGAATGGCTTTGACAAAC

TTGACCTTTGGAGATGTTGCCAACAAG GCTACGCTGTGTTCTATGAAAGGCTGCATGAGAGCACTTGTGGCCCAGTTAAAATCTGAGAGTGAAGACTTA

CAGCAG GTTATTGCAAGTGTTTTGAGGAATTTGTCTTGGCGAGCAGATGTAAATAGCAAAAAGACGTTGAGAGAAGTTGGAAGTGTGAAAGCATTGATG

GAATGTGCTTTGGAAGTTAAAAAG - UNI33575 - GAATCAACCCTCAAAAGCGTTTTGAGTGCCTTATGGAACCTGTCTGCACACTGCACTGAGAA

TAAGGCTGACATCTGTGCTGTGGATGGAGCACTGGCATTTCTGGTTGGCACCCTCACTTACCGGAGCCAGACAAATACTTTAGCCATTATTGAAAGTGGA

GGTGGGATATTACGGAATGTGTCCAGCTTGATAGCTACAAACGAAGACCACAG GCAAATCCTAAGAGAGAACAATTGCCTACAAACTTTATTACAGCAC

TTGAAATCTCACAGCTTGACAATAGTCAGTAATGCATGTGGAACTTTGTGGAATCTCTCAGCAAGAAATCCTAAAGACCAGGAAGCCTTGTGGGACATGG

GGGCAGTGAGCATGCTCAAGAACCTCATTCATTCCAAGCACAAAATGATTGCCATGGGAAGTGCAGCAGCTTTAAGGAATCTCATGGCAAACAGACCTGC

AAAGTATAAGGATGCCAATATCATGTCTCCCGGCTCAAGTCTGCCATCCCTTCACGTTAGGAAACAGAAAGCTCTAGAAGCTGAGCTAGATGCTCAGCAT

TTATCAGAAACCTTCGACAACATTGACAACCTAAGTCCCAAGGCCTCTCACCGGAGTAAGCAGAGACACAAGCAGAATCTTTATGGTGACTATGCTTTTG

ACGCCAATCGACATGATGATAGTAGGTCAGACAATTTCAATACTGGAAACATGACTGTTCTTTCACCATATTTAAATACTACGGTATTGCCCAGCTCTTC

TTCCTCAAGGGGAAGTTTAGACAGTTCTCGTTCTGAGAAAGACAGAAGTTTGGAGAGAGAGCGAGGTATTGGCCTCAGTGCTTACCATCCAACAACAGAA

AATGCAGGAACCTCATCAAAACGAGGTCTGCAGATCACTACCACTGCAGCCCAGATAGCCAAAGTTATGGAAGAAGTATCAGCCATTCATACCTCCCAGG

ACGACAGAAGTTCTGCTTCTACCACCGAGTTCCATTGTGTGGCAGACGACAGGAGTGCGGCACGAAGAAGCTCTGCCTCCCACACACACTCAAACACATA

CAACTTCACTAAGTCGGAAAATTCAAATAGGACATGCTCTATGCCTTATGCCAAAGTGGAATATAAACGATCTTCAAATGACAGTTTAAATAGTGTCACT

AGTAGTGATGGATATGGTAAAAGAGGCCAAATGAAACCCTCAGTTGAATCCTATTCTGAAGATGATGAAAGTAAATTTTGCAGTTATGGTCAGTATCCAG

CTGACCTAGCCCATAAGATACACAGTGCAAATCATATGGATGATAATGATGGAGAACTGGATACACCAATAAATTACAGTCTTAAATATTCAGATGAGCA

GTTGAACTCAGGAAGGCAGAGTCCCTCACAGAATGAAAGGTGGGCAAGACCAAAGCATGTGATAGAAGATGAAATAAAGCAAAACGAGCAAAGACAAGCA

AGAAGCCAGAACACCAGTTATCCTGTCTATTCTGAGAATACCGATGACAAACACCTCAAATTCCAACCACATTTTGGACAACAAGAATGTGTTTCCCCAT

ATAGGTCAAGGGGAACCAGTGGTTCAGAAACAAATCGAATGGGTTCTAGTCATGCAATTAATCAAAATGTAAACCAGTCTCTGTGTCAGGAAGATGATTA

TGAAGATGATAAACCTACCAACTACAGTGAACGTTATTCTGAGGAAGAACAACATGAAGAAGAAGAAGAGAGACCGACAAATTATAGCATAAAATATAAT

GAAGAGAAACATCATGTGGATCAGCCTATTGATTATAGTTTAAAATATGCCACTGACATTTCTTCCTCACAAAAACCATCATTTTCATTCTCAAAGAATT

CATCAGCACAAAGCACTAAACCTGAACATCTCTCTCCAAGCAGCGAGAATACAGCTGTACCTCCATCTAATGCCAAAAGGCAGAATCAGCTGCGTCCAAG

TTCAGCACAAAGAAATGGCCAGACTCAAAAAGGCACTACTTGCAAAGTCCCCTCCATCAACCAAGAAACAATACAGACTTACTGCGTAGAAGACACCCCA

ATATGTTTTTCAAGGTGCAGTTCATTATCATCACTGTCATCAGCTGACGATGAAATAGGATGTGATCAGACAACACAGGAAGCAGATTCTGCTAATACTC

TGCAGACAGCAGAAGTAAAAGAGAATGATGTAACTCGGTCAGCTGAAGATCCTGCAACTGAAGTTCCAGCAGTGTCCCAGAATGCTAGAGCCAAACCCAG

CCGACTCCAGGCTTCTGGCTTATCTTCAGAATCAACCAGGCATAATAAAGCTGTTGAGTTTTCTTCAGGAGCCAAGTCTCCCTCCAAAAGTGGTGCTCAG

ACACCCAAAAGTCCCCCAGAACACTATGTCCAGGAGACTCCGCTCGTATTCAGCAGGTGTACTTCTGTCAGCTCCCTTGACAGTTTTGAGAGTCGCTCCA

TTGCCAGCTCTGTTCAGAGTGAGCCATGTAGTGGAATGGTGAGTGGCATCATAAGCCCCAGTGACCTTCCAGATAGTCCTGGGCAGACCATGCCACCAAG

CAGAAGCAAAACCCCTCCACCTCCTCCACAGACAGTGCAGGCCAAGAGAGAGGTGCCAAAAAGTAAAGTCCCTGCTGCTGAGAAGAGAGAGAGTGGGCCT

AAGCAGACTGCTGTAAATGCTGCCGTGCAGAGGGTGCAGGTCCTTCCAGACGTGGATACTTTGTTACACTTCGCCACAGAAAGTACTCCAGACGGGTTTT

CTTGTTCCTCCAGCCTAAGTGCTCTGAGCCTGGATGAGCCATTTATACAGAAAGATGTAGAATTAAGAATCATGCCTCCAGTTCAGGAAAACGACAATGG

GAATGAAACTGAATCAGAACAGCCTGAGGAATCAAATGAAAACCAGGATAAAGAGGTAGAAAAGCCTGACTCTGAAAAAGACTTATTAGATGATTCTGAT

GACGATGATATTGAAATATTAGAAGAATGTATTATTTCAGCCATGCCAACAAAGTCATCACGCAAAGCCAAAAAACTAGCCCAGACTGCTTCAAAATTAC

CTCCACCTGTGGCAAGGAAACCAAGTCAGCTACCTGTGTATAAACTTCTGCCAGCACAGAATAGGCTGCAGGCACAAAAACATGTTAGCTTTACACCAGG

GGATGATGTGCCCCGGGTGTACTGTGTAGAAGGGACACCTATAAACTTTTCCACAGCAACGTCTCTAAGTGATCTGACAATAGAGTCCCCTCCAAATGAA

TTGGCTACTGGAGATGGGGTCAGAGCGGGTATACAGTCAGGTGAATTTGAAAAACGAGATACCATTCCTACAGAAGGCAGAAGTACAGATGATGCTCAGC

GAGGAAAAATCTCATCTATAGTTACACCAGACCTGGATGACAACAAAGCAGAGGAAGGAGATATTCTTGCAGAATGTATCAATTCTGCTATGCCCAAAGG

AAAAAGCCACAAGCCTTTCCGAGTGAAAAAGATAATGGACCAAGTCCAACAAGCATCCTCGACTTCATCTGGAGCTAACAAAAATCAAGTAGACACTAAG

AAAAAGAAGCCTACTTCACCAGTAAAGCCCATGCCACAAAATACTGAATATAGAACGCGTGTGAGAAAGAATACAGACTCAAAAGTTAATGTAAATACTG

AAGAAACTTTCTCAGACAACAAAGACTCAAAGAAACCAAGCTTACAAACCAATGCCAAGGCCTTCAATGAAAAGCTACCTAACAATGAAGACAGAGTGCG

GGGGAGCTTCGCCTTGGACTCACCGCATCACTACACCCCTATTGAGGGGACGCCGTACTGCTTTTCCCGAAATGACTCCTTGAGTTCTCTGGATTTTGAT

GATGACGATGTTGACCTTTCCAGGGAAAAGGCCGAGTTAAGAAAGGGCAAAGAAAGCAAGGATTCCGAAGCCAAAGTTACCTGCCGCCCAGAACCAAACT

CAAGCCAGCAGGCAGCTAGTAAGTCACAAGCCAGTATAAAACATCCAGCAAACAGAGCACAGTCCAAACCAGTGCTGCAGAAACAGCCCACTTTCCCCCA

GTCCTCCAAAGACGGACCAGATAGAGGGGCAGCAACTGACGAAAAACTGCAGAATTTTGCTATTGAAAATACTCCAGTTTGCTTTTCTCGAAATTCCTCT

CTGAGTTCCCTTAGTGACATTGACCAGGAAAACAACAATAACAAAGAAAGTGAACCAATCAAAGAAGCTGAACCTGCCAACTCACAAGGAGAGCCCAGTA

AGCCTCAGGCATCCGGGTATGCTCCCAAGTCCTTCCACGTCGAAGACACCCCTGTCTGTTTCTCAAGAAACAGCTCTCTCAGTTCTCTTAGCATTGACTC

TGAGGACGACCTGTTACAGGAGTGTATAAGTTCTGCCATGCCAAAAAAGAAAAGGCCTTCAAGACTCAAGAGTGAGAGCGAAAAGCAGAGCCCTAGAAAA

GTGGGTGGCATATTAGCTGAAGACCTGACGCTTGATTTGAAAGATCTACAGAGGCCAGATTCAGAACACGCTTTCTCCCCCGACTCAGAAAATTTTGACT

GGAAAGCTATTCAGGAAGGCGCAAACTCCATAGTAAGTAGTTTGCACCAAGCTGCTGCAGCCGCCGCGTGCTTATCTAGACAAGCGTCATCCGACTCAGA

TTCCATTCTGTCACTAAAGTCCGGCATTTCTCTGGGATCGCCTTTTCATCTTACACCTGATCAAGAGGAAAAGCCATTCACAAGCAATAAAGGCCCAAGA

ATTCTCAAACCTGGAGAGAAAAGCACATTAGAAGCAAAAAAAATAGAATCTGAAAACAAAGGAATCAAAGGCGGGAAAAAGGTTTATAAAAGCTTGATTA

CGGGAAAGATTCGCTCCAATTCAGAAATTTCCAGCCAAATGAAACAACCCCTCCCGACAAACATGCCTTCAATCTCAAGAGGCAGGACGATGATTCACAT

CCCAGGGCTTCGGAATAGCTCCTCTAGTACAAGCCCTGTCTCTAAGAAAGGCCCACCCCTCAAGACTCCAGCCTCTAAAAGCCCCAGTGAAGGGCCGGGA

GCTACCACTTCTCCTCGAGGAACTAAGCCAGCAGGAAAGTCAGAGCTTAGCCCTATCACCAGGCAAACTTCCCAAATCAGTGGGTCAAATAAGGGGTCTT

CTAGATCAGGATCTAGAGACTCCACTCCCTCAAGACCTACACAGCAACCATTAAGTAGGCCAATGCAGTCTCCAGGGCGAAACTCAATTTCCCCTGGTAG

AAATGGAATAAGCCCTCCTAACAAACTGTCTCAGCTGCCCAGAACATCATCTCCCAGTACTGCTTCAACTAAGTCCTCCGGTTCTGGGAAAATGTCATAT

ACATCCCCAGGTAGACAGCTGAGCCAACAAAATCTTACCAAACAAGCAAGTTTATCCAAGAATGCCAGCAGTATCCCCAGAAGTGAGTCGGCATCTAAAG

GACTGAATCAGATGAGTAACGGCAATGGGTCAAATAAAAAGGTAGAACTTTCTAGAATGTCTTCAACTAAATCAAGTGGAAGTGAATCAGACAGATCAGA

AAGGCCTGCATTAGTACGCCAGTCTACTTTCATCAAAGAAGCCCCAAGCCCAACCCTGAGGAGGAAACTGGAGGAATCTGCCTCATTTGAATCCCTTTCT

CCATCTTCTAGACCAGATTCTCCCACCAGGTCGCAGGCACAGACCCCAGTTTTAAGCCCTTCCCTTCCTGATATGTCTCTGTCCACACATCCATCTGTTC

AGGCAGGTGGGTGGCGAAAGCTCCCGCCTAATCTCAGCCCCACTATCGAGTATAATGACGGAAGGCCCACAAAACGGCATGATATTGCACGCTCCCATTC

TGAAAGTCCTTCCAGACTACCAATCAACCGGGCGGGAACCTGGAAGCGTGAACACAGCAAACATTCCTCGTCCCTTCCTCGAGTGAGTACTTGGAGAAGA

ACTGGAAGCTCATCTTCTATTCTTTCTGCTTCATCAGAGTCCAGTGAAAAAGCAAAAAGTGAGGATGAAAGGCATGTGAGCTCCATGCCAGCACCCAGAC

AGATGAAGGAAAACCAGGTGCCCACCAAAGGAACATGGAGGAAAATCAAGGAAAGTGACATTTCTCCCACAGGCATGGCTTCTCAGAGCGCTTCCTCAGG

TGCTGCCAGTGGTGCTGAATCCAAGCCTCTGATCTATCAGATGGCACCTCCTGTCTCTAAAACAGAGGATGTTTGGGTGAGAATTGAGGACTGCCCCATT

AACAACCCTAGATCTGGACGGTCCCCCACAGGCAACACCCCCCCAGTGATTGACAGTGTTTCAGAGAAGGGAAGTTCAAGCATTAAAGATTCAAAAGACA

CCCATGGGAAACAGAGTGTGGGCAGTGGCAGTCCTGTGCAAACCGTGGGTCTGGAAACCCGCCTCAACTCCTTTGTTCAGGTAGAGGCCCCAGAACAGAA

AGGAACTGAGGCAAAACCAGGACAGAGTAACCCAGTCTCTATAGCAGAGACTGCTGAGACGTGTATAGCAGAGCGTACCCCTTTCAGTTCCAGTAGCTCC

AGCAAGCACAGCTCACCTAGCGGGACTGTTGCTGCCAGAGTGACACCTTTTAATTACAACCCTAGCCCTAGGAAGAGCAGCGCAGACAGCACTTCAGCCC

GGCCGTCTCAGATCCCTACGCCAGTGAGCACCAACACGAAGAAGAGAGATTCGAAGACTGACAGCACAGAATCCAGTGGAGCCCAAAGTCCTAAACGCCA

TTCCGGGTCTTACCTCGTGACGTCTGTTTAAAAGAGCTAGAAGGACAAACGTAGAAAAGCTGGTGTTAATCACTACTGCTGTATAGAGACTTTATTTCAA

AGAAAACTTTAAAGGTTGAAAATTTTTGTAAATAGGTTTGATTCTTGTTAGAGGGGTTTTGTTCTGGAAACCATATTTGATAGTACACTTTGTCCTCACT

GGTCATTTTGGGAGGCACTCTTATTAGGTAGGAAAAAATGGTAAAGCCAAGTATATTTGTACAGTGTGTTTTACATGTATTTAAGTAGCATCCATCCCAT

TGTCCTTTAATTATCACCTGTCTTAAAAATAACACTACAGATAGAAACTATATGATATATTGCTGTCATCAATCACTTTTAGATTATAAATTAAACTTAC

ATCAGGGAGAAATTGGTATTTATGCAAAAAAAATTAGTCCTTGTGAATCCATCTAATGTCATAATTAATCATGTGGCTGTGAAATTCACAGTAATGTGGT

TCCCCATGAATATGTTTACCCAGCCTGCTTTGCTTTACTGCATGAATGAAGCTGACGGTTCAATTTCAGAAGTAACAATTAATGATTCTGTGATCACATG

GTGTGCAGAGAGATAGCTACAGTGTAACGATTCACACTATTTTGTGCTCAAATCTGTGTAACTGTAAAGCATTGAATGAAACTATTTTAACTGAACTAGA

TTTTATCAAAAGTAGGTAGAATTTTTGCTATGCTGTAACTGTTGTATATTCTGGTATTTGAGGTGAGTTGGCTGCTCTTTTATTAATGAGACACGAATTG

TGTCTCAAACTAAATGAACATTTCAGAATAAATTATTGCTGTATGTAAACTATTACTGAAATTGGTATTTGTTTGAGGGTCTTATTTCACATTTGTATTA

ATAACTGTCAAAAGGGCCTCTTTTAAAAGCTAAATGTAATTTTTTTTCTTCAGATTCTATGCATTAAGAGTAAAATTTCCTCTTGCTGTAATAAAGACAA

TTGAAGAAGATTGTTGACACTTAACCATTCCTAAAATTTATTTTTATGTAATTAGCACCTCTCAATGCTTGGTATTTTTCCACTTTTTTTCTTACTCCTT

GGGGGTTTGATTAAAACAAATGCCTATAATAGCACAAGACTAGGCACTGGACATAAGGGCCCACATAGAATATCTCCTTTTCCTTAATAGAATCCATACT

TGAAAACCATTGATTCTTGACAGTTACCAGTTTTGTCTTTCAGGCTTTCCAGTGCAACTGTCTTACCCCGTCATCTTCTCCGTATTGATACTGGGTCTGA

AATAAATGCCTACTACCACTCTGTATAGTAAGGCAGATTTTTTTTTGCAATCAGGCATAATCAGTATTTTCTCATACTCAAAAAATACAAGTCAGTGAAA

CATCAGAGATATGTAATGCTGTTATGATAATATTTCAAGAAAGATTCAAAAGTGGGCCAGGTCAGTAGGTAAAGGTGATGCCTCAAAGCCTGAAGGCCCA

GTTCACATCACAGGATGCACATGGCAGAAGG
Translation
 - UNI2975 - - UNI18214 - MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMK EVLKQLQGSIEDETMTSGQIDLLERLKE

 - UNI22999 - EFNLDSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPRRTFVNGSRESTGYLEELEKER RSLLLADLDKEEKEKDWY

YAQLQNLTKRIDSLPLTEN FSLQTDMTRRQLEYEARQIRAAMEEQLGTCQDMEKRAQ - UNI7476 - RRIARIQQIEKDILRVRQLLQSQAAEAE 

- UNI10387 - RSSQSRHDAASHEAGRQHEGHGVAESNTAASSSGQ SPATRVDHETASVLSSSGTHSAPRRLTSHLGTK VEMVYSLLSMLGTHDKD

DMSRTLLAMSSSQDSCISMRQSGCLPLLIQLLHGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETCWEWQEAHE

QGMDQDKNPM MPAPVEHQICPAVCVLMKLSFDEEHRHAMNELG GGLQAIAELLQVDCEMYGLTNDHYSVTLRRYAGMALTNLTFGDVANK ATLCSMK

GCMRALVAQLKSESEDLQQ VIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKK - UNI33575 - ESTLKSVLSALWNLSAHCTENKADICA

VDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHR RQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSM

LKNLIHSKHKMIAMGSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLSPKASHRSKQRHKQNLYGDYAFDANRH

DDSRSDNFNTGNMTVLSPYLNTTVLPSSSSSRGSLDSSRSEKDRSLERERGIGLSAYHPTTENAGTSSKRGLQITTTAAQIAKVMEEVSAIHTSQDDRSS

ASTTEFHCVADDRSAARRSSASHTHSNTYNFTKSENSNRTCSMPYAKVEYKRSSNDSLNSVTSSDGYGKRGQMKPSVESYSEDDESKFCSYGQYPADLAH

KIHSANHMDDNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHVIEDEIKQNEQRQARSQNTSYPVYSENTDDKHLKFQPHFGQQECVSPYRSRG

TSGSETNRMGSSHAINQNVNQSLCQEDDYEDDKPTNYSERYSEEEQHEEEEERPTNYSIKYNEEKHHVDQPIDYSLKYATDISSSQKPSFSFSKNSSAQS

TKPEHLSPSSENTAVPPSNAKRQNQLRPSSAQRNGQTQKGTTCKVPSINQETIQTYCVEDTPICFSRCSSLSSLSSADDEIGCDQTTQEADSANTLQTAE

VKENDVTRSAEDPATEVPAVSQNARAKPSRLQASGLSSESTRHNKAVEFSSGAKSPSKSGAQTPKSPPEHYVQETPLVFSRCTSVSSLDSFESRSIASSV

QSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTPPPPPQTVQAKREVPKSKVPAAEKRESGPKQTAVNAAVQRVQVLPDVDTLLHFATESTPDGFSCSSS

LSALSLDEPFIQKDVELRIMPPVQENDNGNETESEQPEESNENQDKEVEKPDSEKDLLDDSDDDDIEILEECIISAMPTKSSRKAKKLAQTASKLPPPVA

RKPSQLPVYKLLPAQNRLQAQKHVSFTPGDDVPRVYCVEGTPINFSTATSLSDLTIESPPNELATGDGVRAGIQSGEFEKRDTIPTEGRSTDDAQRGKIS

SIVTPDLDDNKAEEGDILAECINSAMPKGKSHKPFRVKKIMDQVQQASSTSSGANKNQVDTKKKKPTSPVKPMPQNTEYRTRVRKNTDSKVNVNTEETFS

DNKDSKKPSLQTNAKAFNEKLPNNEDRVRGSFALDSPHHYTPIEGTPYCFSRNDSLSSLDFDDDDVDLSREKAELRKGKESKDSEAKVTCRPEPNSSQQA

ASKSQASIKHPANRAQSKPVLQKQPTFPQSSKDGPDRGAATDEKLQNFAIENTPVCFSRNSSLSSLSDIDQENNNNKESEPIKEAEPANSQGEPSKPQAS

GYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLQECISSAMPKKKRPSRLKSESEKQSPRKVGGILAEDLTLDLKDLQRPDSEHAFSPDSENFDWKAIQ

EGANSIVSSLHQAAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPFTSNKGPRILKPGEKSTLEAKKIESENKGIKGGKKVYKSLITGKIR

SNSEISSQMKQPLPTNMPSISRGRTMIHIPGLRNSSSSTSPVSKKGPPLKTPASKSPSEGPGATTSPRGTKPAGKSELSPITRQTSQISGSNKGSSRSGS

RDSTPSRPTQQPLSRPMQSPGRNSISPGRNGISPPNKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQLSQQNLTKQASLSKNASSIPRSESASKGLNQM

SNGNGSNKKVELSRMSSTKSSGSESDRSERPALVRQSTFIKEAPSPTLRRKLEESASFESLSPSSRPDSPTRSQAQTPVLSPSLPDMSLSTHPSVQAGGW

RKLPPNLSPTIEYNDGRPTKRHDIARSHSESPSRLPINRAGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSESSEKAKSEDERHVSSMPAPRQMKEN

QVPTKGTWRKIKESDISPTGMASQSASSGAASGAESKPLIYQMAPPVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDSVSEKGSSSIKDSKDTHGKQ

SVGSGSPVQTVGLETRLNSFVQVEAPEQKGTEAKPGQSNPVSIAETAETCIAERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQI

PTPVSTNTKKRDSKTDSTESSGAQSPKRHSGSYLVTSV

For any suggestions or comments, please send an email to unitrap@crg.es