Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000005882 (Uqcc)
Chromosomal location
Chr 2: 155672632 - 155756046 (-)
Description
ubiquinol-cytochrome c reductase complex chaperone, CBP3 homolog (yeast) Gene [Source:MGI (curated);Acc:Uqcc-010]
RefSeq_dna
NM_018888 
RefSeq_peptide
NP_061376.1 
UniGene
Mm.398953 
MGI
MGI:1929472 
Uniprot/SWISSPROT
Q9CWU6 
Uniprot/SPTREMBL
A2ARK1 A6PWX9 A6PWX5 A6PWX7 
Human Ortholog
ENSG00000101019 (UQCC)
Omim not available
UniTrap UNI4822
Vector Insertion
Chr 2: 155755748 - 155755787
Public Clones AM0809 (sanger) XL142 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5018
Vector Insertion
Chr 2: 155747370 - 155747464
Public Clones YTC442 (baygenomics)
Private Clones OST196977 (lexicon) OST191448 (lexicon) OST102166 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29912
Vector Insertion
Chr 2: 155747370 - 155755780
Public Clones (sanger) E022D09 (ggtc) PST20542-NR (escells) IST11923A1 (tigm) IST10098B11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25882
Vector Insertion
Chr 2: 155737481 - 155737573
Public Clones not available
Private Clones OST154925 (lexicon) OST62869 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23464
Vector Insertion
Chr 2: 155712954 - 155727033
Public Clones not available
Private Clones OST258429 (lexicon) OST101351 (lexicon)
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17644
Vector Insertion
Chr 2: 155677209 - 155683847
Public Clones not available
Private Clones OST439093 (lexicon)
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109636
Sequence
GATTGTGGAGGAACATGGCGTTGCTGGTGCGAGTCCTT - UNI4822 - - UNI5018 - - UNI29912 - AGGAACCAGACTAGCATCTCTCAG

TGGGTTCCAGTATGCAGCCAACTGGTATCAGTGTCTCCTACCCAAAGACAGTGGAGCAGCACTTCCCAG - UNI5018 - - UNI25882 - - UNI

29912 - TGGCTCCAGAAGAATCAGTCTCGAGTGTGTTTGGGATCAGAACAGACTGTTGGAGCGGACACAGCGCAGAATAGGAAATACCACAACACAAG

TAAG CTTCTTACTACCCAAGATTTCCCACAGCCTGTTGAAGAGAAGGTCGGTCCCTTCACGAAGATAATAGAAGCCATGGGATTCACTGGACCTTTGAA

ATACAGTAAATGG AAGATCAAGATCGCGGCCCTCCGCATGTACACGAGCTGCGTGGAGAAGACTGACTTCGAGGAGTTCTTTCTGA GGTGTCAGATGC

CCGATACATTCAACTCCTGGTTTCTCATAACCCTGCTTCATGTCTG - UNI23464 - GATGTGTCTAGTCCGAATGAAGCAGGAAGGCCGGACTGGG

AAGTACATGTGCCGGATCATAGTTCATTTCATGTGGGAAGATGTGGAGCAGCGCGGCCGCGTCATGGGG GTTAATTCCTATATCCTAAAGAAGAACATG

GCCCTCATGACGAACAATTTCTATGCAGCAATCTTGGGATACGATGAG - UNI17644 - GGGATCCTTTCAGATGACCATGGCCTGGCTGCTGCGCT

CTGGAGGACCTTCTTCAACCAGAAATGTGAGGACCCTCGACAGCTTGAATTGCTGGTGGAATATGTGAGGAAACAG ATGCAATACCTGGACTCCATGAA

CGGTGAGGATCTGCTGCTGACAGGGGAAGTGAGATGGCGCCCTCTGGTGGAGAAGAATCCACAAAGCATCTTGAAGCCCCATGCTCCTACTTACAATGAT

GAGGGCCTTTGAGAGACTGGTCCCTCCGGACAGCTGGCTGGCTGGCTTTGAGGACCTTCCATGGAAGAAGTGCCTGTTTGCCCCAGGACCCTGAAGAAGG

TGGCCTGAACTGACTTGTGAACAGTACCTGTTGAATACTCAGCCCACTCGTGTTGAGTTTCTTCTTCCTGATCTGGTGGGGTTACTGGGGAGGTCCTCTT

GCTCTTTGACAGGTCCCCTCCCTCAAGAGAAGCCCCAGGCACACTTCCCAAGTCCCCTCAGCACCACACGTGACTGAGAGCTTTTTCCGAAGGCTGAGGA

AGGGATGGGTAGGTTAGAAGGGGGTGCCTTCACTCAGAAACCCCTGTGCTTGGAGCAGTTTATTAAGTTCCAAAGTCACAGTGGGTAACCATATACTGTT

CCCCCTCTGTGAGCCATGGGGTTGAAGTAGCCATTAAAAAGAGAGACTTATTTCTGCCATGGTTTTTCTTTGTTCCAAGGTCTTTTAGAAACATAGTTAA

AGCCCAGTGTAGTGGTGCATGTCTTTAGTCCAAGTATTTGGGAAGCAGAGGCAGATGACTCTAGCTAGGTTCTAGGTCAGCATGATCTACAGAGTGAATT

ACAGGGCAGGCAGAGCTACACAGAGAAAGCCTGTCTTGAAAAAACAAGAGAAAAGAAAAGTGCAGGTGAGGCCGTGGGTTCTCCAAGCTCAGGGAATAAC

TGCAGCTCAGTTAGAGGCAGCACGGAGAGGAGCGGAGAGGAGAGGAGAGGAGAAGAGGCCAGGGGCTCTCTGCTGCTACTCCTGTCCCCAGGTCACAGAG

AGGAGTCACTGTCTGGGCAAGGTACAGTCTGCCAGGCATGTTCACTGAGATCCAGGAGGTCTCAGGACCAAGGGGCTTGTCACATCCTAAGTCATTTAGA

AAGAACAAAAGTCCCTTTGTCACCCACAGTGAACTGGGGAAGGAACACACTCTCCGCACTTGGCCTCTCTTTACGTGAGATACTGTGGCGTGCTGGTACC

ATCCAAGCCTCGGCCCGGTGTCTATCCCCTCCCCAAGTTCTAAAGCACGGGCTGTGATGGGAACTTGAGGGGCCTTTTCTCTCTGGGCACTTGAAGGGTC

TGTTCTCTCTCCCCCGAGACTTTGGGTCATCTCTTGGAAGGTTTTCTGAAATTGAGGAACGGGGGTGGGGCCCGTCTCCTCCCTCCCTTCCCCCACCCAG

CTTCCTTCATTGAACTTGCTATAAAATGAGTCATATGAAGAAACCCTATACTGTGAGGTATGCGCCACTTCTGTGAAAACATTACAAATCAAGCCGCCTT

CTCAGTTTATTTAAGATGCTTTTGTTGCAAGCGGGGCTCTGGAGTGAGGCGTCCTCTGTGAGCATGAGATAATAGCACCTTGTAACTCATTACATCTGGG

CACTATTTACATAAACCAGAGGCGAGCCAGGCAGGGATTTGCTGATTAATTTATTTTTAATGGACTGAAGTATGCCATGCACCAAAATAAACTTTACTGT

GTGTACC
Translation
MALLVRVL - UNI4822 - - UNI5018 - - UNI29912 - RNQTSISQWVPVCSQLVSVSPTQRQWSSTSQ - UNI5018 - - UNI25882

 - - UNI29912 - WLQKNQSRVCLGSEQTVGADTAQNRKYHNTSK LLTTQDFPQPVEEKVGPFTKIIEAMGFTGPLKYSKW KIKIAALRMYTSCV

EKTDFEEFFLR RCQMPDTFNSWFLITLLHVW - UNI23464 - WMCLVRMKQEGRTGKYMCRIIVHFMWEDVEQRGRVMG VNSYILKKNMALMTNN

FYAAILGYDE - UNI17644 - GILSDDHGLAAALWRTFFNQKCEDPRQLELLVEYVRKQ MQYLDSMNGEDLLLTGEVRWRPLVEKNPQSILKPHAP

TYNDEGL
Transcript ENSMUST00000109633
Sequence
GATTGTGGAGGAACATGGCGTTGCTGGTGCGAGTCCTT - UNI4822 - - UNI5018 - - UNI29912 - AGGAACCAGACTAGCATCTCTCAG

TGGGTTCCAGTATGCAGCCAACTGGTATCAGTGTCTCCTACCCAAAGACAGTGGAGCAGCACTTCCCAG - UNI5018 - - UNI25882 - - UNI

29912 - TGGCTCCAGAAGAATCAGTCTCGAGTGTGTTTGGGATCAGAACAGACTGTTGGAGCGGACACAGCGCAGAATAGGAAATACCACAACACAA 

- UNI23464 - - UNI25882 - CAATCTTGGGATACGATGAG - UNI17644 - GGGATCCTTTCAGATGACCATGGCCTGGCTGCTGCGCTCT

GGAGGACCTTCTTCAACCAGAAATGTGAGGACCCTCGACAGCTTGAATTGCTGGTGGAATATGTGAGGAAACAG ATGCAATACCTGGACTCCATGAACG

GTGAGGATCTGCTGCTGACAGGGGAAGTGAGATGGCGCCCTCTGGTGGAGAAGAATCCACAAAGCATCTTGAAGCCCCATGCTCCTACTTACAATGATGA

GGGCCTTTGAGAGACTGGTCCCTCCGGACAGCTGGCTGGCTGGCTTTGAGGACCTTCCATGGAAGAAGTGCCTGTTTGCCCCAGGACCCTGAAGAAGGTG

GCCTGAACTGACTTGTGAACAGTACCTGTTGAATACTCAGCCCACTCGTGTTGAGTTTCTTCTTCCTGATCTGGTGGGGTTACTGGGGAGGTCCTCTTGC

TCTTTGACAGGTCCCCTCCCTCAAGAGAAGCCCCAGGCACACTTCCCAAGTCCCCTCAGCACCACACGTGACTGAGAGCTTTTTCCGAAGGCTGAGGAAG

GGATGGGTAGGTTAGAAGGGGGTGCCTTCACTCAGAAACCCCTGTGCTTGGAGCAGTTTATTAAGTTCCAAAGTCACAGTGGGTAACCATATACTGTTCC

CCCTCTGTGAGCCATGGGGTTGAAGTAGCCATTAAAAAGAGAGACTTATTTCTGCCATGGTTTTTCTTTGTTCCAAGGTCTTTTAGAAACATAGTTAAAG

CCCAGTGTAGTGGTGCATGTCTTTAGTCCAAGTATTTGGGAAGCAGAGGCAGATGACTCTAGCTAGGTTCTAGGTCAGCATGATCTACAGAGTGAATTAC

AGGGCAGGCAGAGCTACACAGAGAAAGCCTGTCTTGAAAAAACAAGAGAAAAGAAAAGTGCAGGTGAGGCCGTGGGTTCTCCAAGCTCAGGGAATAACTG

CAGCTCAGTTAGAGGCAGCACGGAGAGGAGCGGAGAGGAGAGGAGAGGAGAAGAGGCCAGGGGCTCTCTGCTGCTACTCCTGTCCCCAGGTCACAGAGAG

GAGTCACTGTCTGGGCAAGGTACAGTCTGCCAGGCATGTTCACTGAGATCCAGGAGGTCTCAGGACCAAGGGGCTTGTCACATCCTAAGTCATTTAGAAA

GAACAAAAGTCCCTTTGTCACCCACAGTGAACTGGGGAAGGAACACACTCTCCGCACTTGGCCTCTCTTTACGTGAGATACTGTGGCGTGCTGGTACCAT

CCAAGCCTCGGCCCGGTGTCTATCCCCTCCCCAAGTTCTAAAGCACGGGCTGTGATGGGAACTTGAGGGGCCTTTTCTCTCTGGGCACTTGAAGGGTCTG

TTCTCTCTCCCCCGAGACTTTGGGTCATCTCTTGGAAGGTTTTCTGAAATTGAGGAACGGGGGTGGGGCCCGTCTCCTCCCTCCCTTCCCCCACCCAGCT

TCCTTCATTGAACTTGCTATAAAATGAGTCATATGAAGAAACCCTATACTGTGAGGTATGCGCCACTTCTGTGAAAACATTACAAATCAAGCCGCCTTCT

CAGTTTATTTAAGATGCTTTTGTTGCAAGCGGGGCTCTGGAGTGAGGCGTCCTCTGTGAGCATGAGATAATAGCACCTTGTAACTCATTACATCTGGGCA

CTATTTACATAAACCAGAGGCGAGCCAGGCAGGGATTTGCTGATTAATTTATTTTTAATGGACTGAAGTATGCCATGCACCAAAATAAACTTTACTGTGT

GTACC
Translation
MALLVRVL - UNI4822 - - UNI5018 - - UNI29912 - RNQTSISQWVPVCSQLVSVSPTQRQWSSTSQ - UNI5018 - - UNI25882

 - - UNI29912 - WLQKNQSRVCLGSEQTVGADTAQNRKYHNTT - UNI23464 - - UNI25882 - TILGYDE - UNI17644 - GILSD

DHGLAAALWRTFFNQKCEDPRQLELLVEYVRKQ MQYLDSMNGEDLLLTGEVRWRPLVEKNPQSILKPHAPTYNDEGL
Transcript ENSMUST00000109632
Sequence
GAGGAACATGGCGTTGCTGGTGCGAGTCCTT - UNI4822 - - UNI5018 - - UNI29912 - AGGAACCAGACTAGCATCTCTCAGTGGGTTC

CAGTATGCAGCCAACTGGTATCAGTGTCTCCTACCCAAAGACAGTGGAGCAGCACTTCCCAG - UNI5018 - - UNI25882 - - UNI29912 -

 TGGCTCCAGAAGAATCAGTCTCGAGTGTGTTTGGGATCAGAACAGACTGTTGGAGCGGACACAGCGCAGAATAGGAAATACCACAACACAAGTAAG CT

TCTTACTACCCAAGATTTCCCACAGCCTGTTGAAGAGAAGGTCGGTCCCTTCACGAAGATAATAGAAGCCATGGGATTCACTGGACCTTTGAAATACAGT

AAATGG AAGATCAAGATCGCGGCCCTCCGCATGTACACGAGCTGCGTGGAGAAGACTGACTTCGAGGAGTTCTTTCTGA GGTGTCAGATGCCCGATAC

ATTCAACTCCTGGTTTCTCATAACCCTGCTTCATGTCTG - UNI23464 - GATGTGTCTAGTCCGAATGAAGCAGGAAGGCCGGACTGGGAAGTACA

TGTGCCGGATCATAGTTCATTTCATGTGGGAAGATGTGGAGCAGCGCGGCCGCGTCATGGGG - UNI17644 - GGGATCCTTTCAGATGACCATGGC

CTGGCTGCTGCGCTCTGGAGGACCTTCTTCAACCAGAAATGTGAGGACCCTCGACAGCTTGAATTGCTGGTGGAATATGTGAGGAAACAG ATGCAATAC

CTGGACTCCATGAACGGTGAGGATCTGCTGCTGACAGGGGAAGTGAGATGGCGCCCTCTGGTGGAGAAGAATCCACAAAGCATCTTGAAGCCCCATGCTC

CTACTTACAATGATGAGGGCCTTTGAGAGACTGGTCCCTCCGGACAGCTGGCTGGCTGGCTTTGAGGACCTTCCATGGAAGAAGTGCCTGTTTGCCCCAG

GACCCTGAAGAAGGTGGCCTGAACTGACTTGTGAACAGTACCTGTTGAATACTCAGCCCACTCGTGTTGAGTTTCTTCTTCCTGATCTGGTGGGGTTACT

GGGGAGGTCCTCTTGCTCTTTGACAGGTCCCCTCCCTCAAGAGAAGCCCCAGGCACACTTCCCAAGTCCCCTCAGCACCACACGTGACTGAGAGCTTTTT

CCGAAGGCTGAGGAAGGGATGGGTAGGTTAGAAGGGGGTGCCTTCACTCAGAAACCCCTGTGCTTGGAGCAGTTTATTAAGTTCCAAAGTCACAGTGGGT

AACCATATACTGTTCCCCCTCTGTGAGCCATGGGGTTGAAGTAGCCATTAAAAAGAGAGACTTATTTCTGCCATGGTTTTTCTTTGTTCCAAGGTCTTTT

AGAAACATAGTTAAAGCCCAGTGTAGTGGTGCATGTCTTTAGTCCAAGTATTTGGGAAGCAGAGGCAGATGACTCTAGCTAGGTTCTAGGTCAGCATGAT

CTACAGAGTGAATTACAGGGCAGGCAGAGCTACACAGAGAAAGCCTGTCTTGAAAAAACAAGAGAAAAGAAAAGTGCAGGTGAGGCCGTGGGTTCTCCAA

GCTCAGGGAATAACTGCAGCTCAGTTAGAGGCAGCACGGAGAGGAGCGGAGAGGAGAGGAGAGGAGAAGAGGCCAGGGGCTCTCTGCTGCTACTCCTGTC

CCCAGGTCACAGAGAGGAGTCACTGTCTGGGCAAGGTACAGTCTGCCAGGCATGTTCACTGAGATCCAGGAGGTCTCAGGACCAAGGGGCTTGTCACATC

CTAAGTCATTTAGAAAGAACAAAAGTCCCTTTGTCACCCACAGTGAACTGGGGAAGGAACACACTCTCCGCACTTGGCCTCTCTTTACGTGAGATACTGT

GGCGTGCTGGTACCATCCAAGCCTCGGCCCGGTGTCTATCCCCTCCCCAAGTTCTAAAGCACGGGCTGTGATGGGAACTTGAGGGGCCTTTTCTCTCTGG

GCACTTGAAGGGTCTGTTCTCTCTCCCCCGAGACTTTGGGTCATCTCTTGGAAGGTTTTCTGAAATTGAGGAACGGGGGTGGGGCCCGTCTCCTCCCTCC

CTTCCCCCACCCAGCTTCCTTCATTGAACTTGCTATAAAATGAGTCATATGAAGAAACCCTATACTGTGAGGTATGCGCCACTTCTGTGAAAACATTACA

AATCAAGCCGCCTTCTCAGTTTATTTAAGATGCTTTTGTTGCAAGCGGGGCTCTGGAGTGAGGCGTCCTCTGTGAGCATGAGATAATAGCACCTTGTAAC

TCATTACATCTGGGCACTATTTACATAAACCAGAGGCGAGCCAGGCAGGGATTTGCTGATTAATTTATTTTTAATGGACTGAAGTATGCCATGCACCAAA

ATAAACTTTACTGTGTGTACCT
Translation
MALLVRVL - UNI4822 - - UNI5018 - - UNI29912 - RNQTSISQWVPVCSQLVSVSPTQRQWSSTSQ - UNI5018 - - UNI25882

 - - UNI29912 - WLQKNQSRVCLGSEQTVGADTAQNRKYHNTSK LLTTQDFPQPVEEKVGPFTKIIEAMGFTGPLKYSKW KIKIAALRMYTSCV

EKTDFEEFFLR RCQMPDTFNSWFLITLLHVW - UNI23464 - WMCLVRMKQEGRTGKYMCRIIVHFMWEDVEQRGRVMG - UNI17644 - GIL

SDDHGLAAALWRTFFNQKCEDPRQLELLVEYVRKQ MQYLDSMNGEDLLLTGEVRWRPLVEKNPQSILKPHAPTYNDEGL
Transcript ENSMUST00000006036
Sequence
GGAGGAACATGGCGTTGCTGGTGCGAGTCCTT - UNI4822 - - UNI5018 - - UNI29912 - AGGAACCAGACTAGCATCTCTCAGTGGGTT

CCAGTATGCAGCCAACTGGTATCAGTGTCTCCTACCCAAAGACAGTGGAGCAGCACTTCCCAG - UNI5018 - - UNI25882 - - UNI29912 

- TGGCTCCAGAAGAATCAGTCTCGAGTGTGTTTGGGATCAGAACAGACTGTTGGAGCGGACACAGCGCAGAATAGGAAATACCACAACACAAGTAAG C

TTCTTACTACCCAAGATTTCCCACAGCCTGTTGAAGAGAAGGTCGGTCCCTTCACGAAGATAATAGAAGCCATGGGATTCACTGGACCTTTGAAATACAG

TAAATGG - UNI23464 - GTTAATTCCTATATCCTAAAGAAGAACATGGCCCTCATGACGAACAATTTCTATGCAGCAATCTTGGGATACGATGAG 

- UNI17644 - GGGATCCTTTCAGATGACCATGGCCTGGCTGCTGCGCTCTGGAGGACCTTCTTCAACCAGAAATGTGAGGACCCTCGACAGCTTGAA

TTGCTGGTGGAATATGTGAGGAAACAG ATGCAATACCTGGACTCCATGAACGGTGAGGATCTGCTGCTGACAGGGGAAGTGAGATGGCGCCCTCTGGTG

GAGAAGAATCCACAAAGCATCTTGAAGCCCCATGCTCCTACTTACAATGATGAGGGCCTTTGAGAGACTGGTCCCTCCGGACAGCTGGCTGGCTGGCTTT

GAGGACCTTCCATGGAAGAAGTGCCTGTTTGCCCCAGGACCCTGAAGAAGGTGGCCTGAACTGACTTGTGAACAGTACCTGTTGAATACTCAGCCCACTC

GTGTTGAGTTTCTTC
Translation
MALLVRVL - UNI4822 - - UNI5018 - - UNI29912 - RNQTSISQWVPVCSQLVSVSPTQRQWSSTSQ - UNI5018 - - UNI25882

 - - UNI29912 - WLQKNQSRVCLGSEQTVGADTAQNRKYHNTSK LLTTQDFPQPVEEKVGPFTKIIEAMGFTGPLKYSKW - UNI23464 - V

NSYILKKNMALMTNNFYAAILGYDE - UNI17644 - GILSDDHGLAAALWRTFFNQKCEDPRQLELLVEYVRKQ MQYLDSMNGEDLLLTGEVRWRP

LVEKNPQSILKPHAPTYNDEGL
Transcript ENSMUST00000109631
Sequence
GAGAGGGATGTGAGAGGCCAGGCCGGGGTGTGTGTAGAGGAAGAACGTGAGCCCTTGTGACGCGCAGCAGCGACTTAAGACCGGCGAGGAGTCTCGCGTC

CTGGAACCTCATTCAGATCCACGGCAGGAAAACCGCGGGTGCGCAGTTGCGAAAACTACGCCTGCGCCGCCTCCAGAGCCTGACTACCTTTAGCAAGGGG

ACAGCGGCTGAGTGGGTGGTGACAATCGGGATTCCGGAAGCCCACCTTTCACCCGGAAATGATTGTGGAGGAACATGGCGTTGCTGGTGCGAGTCCTT -

 UNI4822 - - UNI5018 - - UNI29912 - AGGAACCAGACTAGCATCTCTCAGTGGGTTCCAGTATGCAGCCAACTGGTATCAGTGTCTCCTA

CCCAAAGACAGTGGAGCAGCACTTCCCAG - UNI5018 - - UNI25882 - - UNI29912 - AAGATCAAGATCGCGGCCCTCCGCATGTACAC

GAGCTGCGTGGAGAAGACTGACTTCGAGGAGTTCTTTCTGA GGTGTCAGATGCCCGATACATTCAACTCCTGGTTTCTCATAACCCTGCTTCATGTCTG

 - UNI23464 - GATGTGTCTAGTCCGAATGAAGCAGGAAGGCCGGACTGGGAAGTACATGTGCCGGATCATAGTTCATTTCATGTGGGAAGATGTGG

AGCAGCGCGGCCGCGTCATGGGG GTTAATTCCTATATCCTAAAGAAGAACATGGCCCTCATGACGAACAATTTCTATGCAGCAATCTTGGGATACGATG

AG - UNI17644 - GGGATCCTTTCAGATGACCATGGCCTGGCTGCTGCGCTCTGGAGGACCTTCTTCAACCAGAAATGTGAGGACCCTCGACAGCTT

GAATTGCTGGTGGAATATGTGAGGAAACAG ATGCAATACCTGGACTCCATGAACGGTGAGGATCTGCTGCTGACAGGGGAAGTGAGATGGCGCCCTCTG

GTGGAGAAGAATCCACAAAGCATCTTGAAGCCCCATGCTCCTACTTACAATGATGAGGGCCTTTGAGAGACTGGTCCCTCCGGACAGCTGGCTGGCTGGC

TTTGAGGACCTTCCATGGAAGAAGTGCCTGTTTGCCCCAGGACCCTGAAGAAGGTGGCCTGAACTGACTTGTGAACAGTACCTGTTGAATACTCAGCCC
Translation
MALLVRVL - UNI4822 - - UNI5018 - - UNI29912 - RNQTSISQWVPVCSQLVSVSPTQRQWSSTSQ - UNI5018 - - UNI25882

 - - UNI29912 - KIKIAALRMYTSCVEKTDFEEFFLR RCQMPDTFNSWFLITLLHVW - UNI23464 - WMCLVRMKQEGRTGKYMCRIIVHF

MWEDVEQRGRVMG VNSYILKKNMALMTNNFYAAILGYDE - UNI17644 - GILSDDHGLAAALWRTFFNQKCEDPRQLELLVEYVRKQ MQYLDSM

NGEDLLLTGEVRWRPLVEKNPQSILKPHAPTYNDEGL
Transcript ENSMUST00000088667
Sequence
GATTGTGGAGGAACATGGCGTTGCTGGTGCGAGTCCTT - UNI4822 - - UNI5018 - - UNI29912 - AGGAACCAGACTAGCATCTCTCAG

TGGGTTCCAGTATGCAGCCAACTGGTATCAGTGTCTCCTACCCAAAGACAGTGGAGCAGCACTTCCCAG - UNI5018 - - UNI25882 - - UNI

29912 - TGGCTCCAGAAGAATCAGTCTCGAGTGTGTTTGGGATCAGAACAGACTGTTGGAGCGGACACAGCGCAGAATAGGAAATACCACAACACAAG

TAAG CTTCTTACTACCCAAGATTTCCCACAGCCTGTTGAAGAGAAGGTCGGTCCCTTCACGAAGATAATAGAAGCCATGGGATTCACTGGACCTTTGAA

ATACAGTAAATGG AAGATCAAGATCGCGGCCCTCCGCATGTACACGAGCTGCGTGGAGAAGACTGACTTCGAGGAGTTCTTTCTGA GGTGTCAGATGC

CCGATACATTCAACTCCTGGTTTCTCATAACCCTGCTTCATGTCTG - UNI23464 - GATGTGTCTAGTCCGAATGAAGCAGGAAGGCCGGACTGGG

AAGTACATGTGCCGGATCATAGTTCATTTCATGTGGGAAGATGTGGAGCAGCGCGGCCGCGTCATGGGG GTTAATTCCTATATCCTAAAGAAGAACATG

GCCCTCATGACGAACAATTTCTATGCAGCAATCTTGGGATACGATGAG - UNI17644 - GGGATCCTTTCAGATGACCATGGCCTGGCTGCTGCGCT

CTGGAGGACCTTCTTCAACCAGAAATGTGAGGACCCTCGACAGCTTGAATTGCTGGTGGAATATGTGAGGAAACAG ATGCAATACCTGGACTCCATGAA

CGGTGAGGATCTGCTGCTGACAGGGGAAGTGAGATGGCGCCCTCTGGTGGAGAAGAATCCACAAAGCATCTTGAAGCCCCATGCTCCTACTTACAATGAT

GAGGGCCTTTGAGAGACTGGTCCCTCCGGACAGCTGGCTGGCTGGCTTTGAGGACCTTCCATGGAAGAAGTGCCTGTTTGCCCCAGGACCCTGAAGAAGG

TGGCCTGAACTGACTTGTGAACAGTACCTGTTGAATACTCAGCCCACTCGTGTTGAGTTTCTTCTTCCTGATCTGGTGGGGTTACTGGGGAGGTCCTCTT

GCTCTTTGACAGGTCCCCTCCCTCAAGAGAAGCCCCAGGCACACTTCCCAAGTCCCCTCAGCACCACACGTGACTGAGAGCTTTTTCCGAAGGCTGAGGA

AGGGATGGGTAGGTTAGAAGGGGGTGCCTTCACTCAGAAACCCCTGTGCTTGGAGCAGTTTATTAAGTTCCAAAGTCACAGTGGGTAACCATATACTGTT

CCCCCTCTGTGAGCCATGGGGTTGAAGTAGCCATTAAAAAGAGAGACTTATTTCTGCCATGGTTTTTCTTTGTTCCAAGGTCTTTTAGAAACATAGTTAA

AGCCCAGTGTAGTGGTGCATGTCTTTAGTCCAAGTATTTGGGAAGCAGAGGCAGATGACTCTAGCTAGGTTCTAGGTCAGCATGATCTACAGAGTGAATT

ACAGGGCAGGCAGAGCTACACAGAGAAAGCCTGTCTTGAAAAAACAAGAGAAAAGAAAAGTGCAGGTGAGGCCGTGGGTTCTCCAAGCTCAGGGAATAAC

TGCAGCTCAGTTAGAGGCAGCACGGAGAGGAGCGGAGAGGAGAGGAGAGGAGAAGAGGCCAGGGGCTCTCTGCTGCTACTCCTGTCCCCAGGTCACAGAG

AGGAGTCACTGTCTGGGCAAGGTACAGTCTGCCAGGCATGTTCACTGAGATCCAGGAGGTCTCAGGACCAAGGGGCTTGTCACATCCTAAGTCATTTAGA

AAGAACAAAAGTCCCTTTGTCACCCACAGTGAACTGGGGAAGGAACACACTCTCCGCACTTGGCCTCTCTTTACGTGAGATACTGTGGCGTGCTGGTACC

ATCCAAGCCTCGGCCCGGTGTCTATCCCCTCCCCAAGTTCTAAAGCACGGGCTGTGATGGGAACTTGAGGGGCCTTTTCTCTCTGGGCACTTGAAGGGTC

TGTTCTCTCTCCCCCGAGACTTTGGGTCATCTCTTGGAAGGTTTTCTGAAATTGAGGAACGGGGGTGGGGCCCGTCTCCTCCCTCCCTTCCCCCACCCAG

CTTCCTTCATTGAACTTGCTATAAAATGAGTCATATGAAGAAACCCTATACTGTGAGGTATGCGCCACTTCTGTGAAAACATTACAAATCAAGCCGCCTT

CTCAGTTTATTTAAGATGCTTTTGTTGCAAGCGGGGCTCTGGAGTGAGGCGTCCTCTGTGAGCATGAGATAATAGCACCTTGTAACTCATTACATCTGGG

CACTATTTACATAAACCAGAGGCGAGCCAGGCAGGGATTTGCTGATTAATTTATTTTTAATGGACTGAAGTATGCCATGCACCAAAATAAACTTTACTGT

GTGTACC
Translation
 - UNI4822 - - UNI5018 - - UNI29912 -  - UNI5018 - - UNI25882 - - UNI29912 -  MGFTGPLKYSKW KIKIAALRM

YTSCVEKTDFEEFFLR RCQMPDTFNSWFLITLLHVW - UNI23464 - WMCLVRMKQEGRTGKYMCRIIVHFMWEDVEQRGRVMG VNSYILKKNMA

LMTNNFYAAILGYDE - UNI17644 - GILSDDHGLAAALWRTFFNQKCEDPRQLELLVEYVRKQ MQYLDSMNGEDLLLTGEVRWRPLVEKNPQSIL

KPHAPTYNDEGL

For any suggestions or comments, please send an email to unitrap@crg.es