Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000005947 (Itgae)
Chromosomal location
Chr 11: 72904085 - 72960943 (+)
Description
integrin alpha E, epithelial-associated Gene [Source:MGI (curated);Acc:Itgae-001]
RefSeq_dna
NM_008399 NM_172944 
RefSeq_peptide
NP_032425.1 NP_766532.1 
UniGene
Mm.96 
MGI
MGI:1298377 
Uniprot/SWISSPROT
Q60677 
Uniprot/SPTREMBL
A2T0Z1 B1AUD5 B2KGB1 Q3U4V9 Q99MV0 Q9JJJ5 B2KGB0 B2RWT2 Q8BS01 
Human Ortholog
ENSG00000083457 (ITGAE)
Omim not available
UniTrap UNI31088
Vector Insertion
Chr 11: 72904157 - 72917362
Public Clones IST11087E2 (tigm) IST11672E1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34574
Vector Insertion
Chr 11: 72952365 - 72954168
Public Clones IST13405D1 (tigm) IST14184E10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21324
Vector Insertion
Chr 11: 72954265 - 72959042
Public Clones (cmhd) CMHD-GT_488C6-3 (cmhd) IST10896H8 (tigm) IST14232G11 (tigm)
IST15063B2 (tigm)
Private Clones OST334280 (lexicon) OST57658 (lexicon) OST28198 (lexicon)
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14138
Vector Insertion
Chr 11: 72959154 - 72960552
Public Clones CMHD-GT_434D7-3 (cmhd) CMHD-GT_405B2-3 (cmhd) CMHD-GT_107A12-3 (cmhd) IST13048H9 (tigm)
Private Clones OST189671 (lexicon) OST149209 (lexicon) OST142367 (lexicon) OST62170 (lexicon)
OST62025 (lexicon) OST58940 (lexicon) OST56575 (lexicon) OST50154 (lexicon)
OST36567 (lexicon) OST25619 (lexicon) OST17412 (lexicon) OST12463 (lexicon)
OST12407 (lexicon) OST5420 (lexicon) OST2398 (lexicon) OST1142 (lexicon)
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000006101
Sequence
CCCACTCAGCTCACACAGCTGCATCTGCTCCAGCTATGAAGTGGCTCTTCCATACCCTTCTCTGCATGGCCA - UNI31088 - GCCTGAAGCCCCAG

GGAGCCTTCAATTTGGATGTGGACTGGGCCTGGGTCACAGCACTCCAGCCAGGTGCACCGGCTGTGCTCAGCTCCCTTCTGCATCAAGACCCCAGCAACA

ACCAGACCTG CCTCCTGGTAGCCAGACGCAGCTCCAACAGGAATACAGCCGCCCTGTATCGATGCGCTATATCCATCAGTCCAGATGAAATTGCTTGCC

AGCCAGTGG AGCACATCTGTATGCCAAAGGGCAGGTACCAGGGAGTGACATTGGTCGGGAACCACAATGGTGTTTTG GTGTGCATTCAGGTACAGGCC

CGGAAGTTCCGCAGCCTCAACTCAGAGCTCACGGGTGCCTGCAGCCTACTCACCCCCAATTTGGACCTCCAGGCCCAAGCCTACTTCTCTGACCTCG AA

GGGTTCCTGGATCCAGGAGCACATGTGGACTCTGGTGACTACTGTAGAAGCAAAGGAGGCAGCACAGGGGAGGAGAAGAAGTCAGCCAGGAGACGCCGGA

CAGTGGAGGAGGAAGACGAGGAGGAAGATG GCACTGAGATCGCTATTGTCCTGGATGGCTCAGGAAGCATTGAACCCTCAGACTTCCAGAAGGCCAAAA

ATTTCATCTCTACCATGATGAGGAACTTCTATGAGAAGTGTTTTGAG TGCAACTTTGCCCTGGTGCAGTATGGGGCCGTGATCCAGACTGAGTTTGATC

TTCAAGAGAGCCGGGACATTAACGCCTCCCTTGCCAAAGTTCAGAGCATCGTTCAAGTGAAGGAAGTCACTAAGACCGCCTCAGCCATGCAGCATGTCCT

 AGACAATATCTTCATTCCAAGCCGTGGCTCCAGAAAAAAAGCATTGAAGGTCATGGTGGTACTTACTGATGGTGACATATTTGGGGACCCTCTCAATCT

TACGACTGTCATCAACTCCCCAAAGATGCAGGGTGTTGTGCGCTTTGCCATTGGG GTGGGTGATGCATTCAAGAATAACAACACTTACAGAGAACTGAA

GCTGATTGCCTCAGACCCCAAAGAGGCCCACACTTTCAAGGTGACCAACTACTCAGCTCTGGATGGGCTGCTGAGCAAGCTGCAACAACACATCGTTCAT

ATGGAAG GTACAGTTGGAGATGCCCTTCAATATCAACTCGCACAGACTGGTTTCAGTGCCCAGATCCTGGACAAG GGGCAGGTGTTGCTTGGCACTGT

GGGGGCCTTTAACTGGTCTGGGGGTGCGCTGCTCTACAGCACACAGAATGGCCGGGGCTGCTTCCTAAACCAGACAGCCAAGGAGGACTCCAGGACTGTA

CAGTACAGCTACCTAG GTTACTCCCTTGCGGTGCTACACAAGGCCCACGGCGTCTCTTACGTGGCAGGGGCTCCAAGGCACAAGCTCCGTGGGGCTGTG

TTTGAGCTCCGGAAGGAGGACAGAGAGGAGGATGCCTTTGTGCGACGGATAGAAGGAGAGCAG ATGGGGTCCTACTTTGGCTCTGTGCTGTGCCCTGTG

GATATCGACATGGATGGGACCACAGATTTTCTACTGGTGGCTGCTCCATTTTACCACATCCGTGGAGAAGAAGGCAGAGTCTATGTGTACCAGGTGCCTG

AGCAG GATGCTTCCTTCTCCTTGGCACACACACTGAGTGGGCACCCTGGGCTCACCAATAGCCGCTTTGGCTTTGCCATGGCAGCTGTGGGGGATATCA

ACCAAGACAAATTCACAGATGTGGCCATTGGGGCCCCTCTGGAGGGTTTTGGGGCAGGTGACGGGGCCAGCTATGGCAGCGTGTACATCTACAACGGACA

CTCAGGTGGCTTGTATGACAGTCCTTCCCAG CAGATCCGAGCCTCCTCTGTGGCCTCGGGACTCCACTACTTCGGCATGTCTGTGTCCGGTGGGTTAGA

TTTCAATGGCGATGGCCTTGCCGATATCACAGTTGGCTCTCGGGACTCGGCGGTTGTGCTCCG CTCACGCCCTGTGGTTGACCTGACCGTATCTATGAC

CTTTACCCCCGATGCACTGCCCATGGTCTTCATAGGCAAGATGGATGTAAAACTGTGTTTTGAAGTTGACTCTTCAGGCGTAGCTTCTGAGCCAG GCCT

TAGAGAGATGTTCCTCAACTTTACGGTGGATGTGGATGTGACCAAGCAAAGGCAGAGGCTGCAGTGTGAGGACTCGAGCGGTTGTCAGAGCTGCCTCAGG

AAGTGGAACGGAGGGTCCTTTCTGTGTGAACACTTCTGGCTCATCTCCACAGAGGAG CTTTGTGAGGAGGACTGCTTCTCCAACATCACCATCAAGGTC

ACCTACGAGTTCCAGACGTCTGGGGGAAGGAGGGACTACCCCAACCCCACCCTGGACCACTACAAGGAACCCTCTGCCATCTTCCAG CTGCCCTACGAG

AAGGACTGCAAGAACAAAGTGTTCTGCATCGCTGAGATCCAGCTGACCACCAACATCTCCCA GCAGGAACTGGTGGTGGGCGTCACAAAGGAGGTGACC

ATGAACATCAGCCTGACTAACTCTGGAGAGGATTCCTACATGACAAACATGGCTCTCAATTATCCCAGAAACTTACAGTTTAAGAAGATACAAAAG CCA

GTATCTCCAGATGTTCAGTGTGATGACCCCAAGCCAGTTGCTTCTGTCCTGGTCATGAACTGCAAGATTGGTCACCCCATACTCAAGAGATCATCT GTG

AATGTCTCAGTAACTTGGCAGCTAGAGGAGAGTGTCTTTCCAAATAGGACAGCAGATATCACTGTGACCATCTCCAA TTCCAATGAGAAGTCTTTGGCC

AGAGAGACACGCAGCCTTCAATTCAGACATGCCTTCATTGCAGTTCTTTCCAG ACCCTCAGTGATGTACATGAACACAAGCCAAAGCCCTTCTGACCAC

AAAGAATTCTTCTTCAAT GTGCATGGGGAGAATCTTTTTGGAGCTGTATTCCAGTTGCAAATTTGTGTCCCCATCAAATTACAAGATTTCCAGATTGTA

AGAGTGAAGAATCTGACAAAGACTCAG GACCACACTGAGTGCACCCAGAGTCAAGAGCCTGCGTGTGGAAGCGATCCTGTGCAG CATGTAAAAGAATG

GCATTCAGTGGTCTGTGCTATCACATCTAATAAAGAAAATGTAACCGTGGCCGCAGAGATCTCCGTGGGCCACACTAAGCAG TTACTAAGAGATGTATC

TGAACTGCCGATCCTTGGTGAAATATCTTTCAACAAATCTCTCTATGAGGGGCTGAATGCAGAGAACCACAGGACGAAG - UNI21324 - ATCACTG

TCATCTTCCTGAAAGAGGAGGAGACACGCTCTTTGCCTCTCATCATTGGCAGCAGCATCGGAGGCCTCCTGGTCTTGGTTGTGATTATAGCCATTTTGTT

CAAG - UNI14138 - TGTGGCTTTTTCAAAAGAAAATATCAACAACTGAACTTGGAGAGCACAAGGAGGGCCCAGCTGAAGGCTGACAGTCTGCTCC

AAGATTAGCCCCCTGCTTCCTCACCGGAAGGAGGGAGTTTGAGCCAGTCGGAAGCCGGGATGCCCCCTATCGGGGCCCCTTACTCTCCTTAGGACGATCA

AGCAACATCAAAGAACTGTAGAGTGTTGTTCATAGCCACACACTATGCCCACAGTGTCTTGTGAATTGAGCAAAAGGGAAACTTAGGATGTGTGCTATTA

AATACATTTACTTTTACAGCAGTGCCTTTAATGAGCACGGTTCCCAGTTTGCCATGCGTTTTGATGACTGATAGACCAAAGTCTTATTCCTATTAAAATA

TTAATTATA
Translation
MKWLFHTLLCMAS - UNI31088 - SLKPQGAFNLDVDWAWVTALQPGAPAVLSSLLHQDPSNNQTC CLLVARRSSNRNTAALYRCAISISPDEIAC

QPVE EHICMPKGRYQGVTLVGNHNGVL VCIQVQARKFRSLNSELTGACSLLTPNLDLQAQAYFSDLE EGFLDPGAHVDSGDYCRSKGGSTGEEKKSA

RRRRTVEEEDEEEDG GTEIAIVLDGSGSIEPSDFQKAKNFISTMMRNFYEKCFE CNFALVQYGAVIQTEFDLQESRDINASLAKVQSIVQVKEVTKTA

SAMQHVL LDNIFIPSRGSRKKALKVMVVLTDGDIFGDPLNLTTVINSPKMQGVVRFAIG VGDAFKNNNTYRELKLIASDPKEAHTFKVTNYSALDGLL

SKLQQHIVHMEG GTVGDALQYQLAQTGFSAQILDK GQVLLGTVGAFNWSGGALLYSTQNGRGCFLNQTAKEDSRTVQYSYLG GYSLAVLHKAHGVSY

VAGAPRHKLRGAVFELRKEDREEDAFVRRIEGEQ MGSYFGSVLCPVDIDMDGTTDFLLVAAPFYHIRGEEGRVYVYQVPEQ DASFSLAHTLSGHPGLT

NSRFGFAMAAVGDINQDKFTDVAIGAPLEGFGAGDGASYGSVYIYNGHSGGLYDSPSQ QIRASSVASGLHYFGMSVSGGLDFNGDGLADITVGSRDSAV

VLR RSRPVVDLTVSMTFTPDALPMVFIGKMDVKLCFEVDSSGVASEPG GLREMFLNFTVDVDVTKQRQRLQCEDSSGCQSCLRKWNGGSFLCEHFWLI

STEE LCEEDCFSNITIKVTYEFQTSGGRRDYPNPTLDHYKEPSAIFQ LPYEKDCKNKVFCIAEIQLTTNISQ QQELVVGVTKEVTMNISLTNSGEDS

YMTNMALNYPRNLQFKKIQK PVSPDVQCDDPKPVASVLVMNCKIGHPILKRSS VNVSVTWQLEESVFPNRTADITVTISN NSNEKSLARETRSLQFR

HAFIAVLSR RPSVMYMNTSQSPSDHKEFFFN VHGENLFGAVFQLQICVPIKLQDFQIVRVKNLTKTQ DHTECTQSQEPACGSDPVQ HVKEWHSVVC

AITSNKENVTVAAEISVGHTKQ LLRDVSELPILGEISFNKSLYEGLNAENHRTK - UNI21324 - ITVIFLKEEETRSLPLIIGSSIGGLLVLVVI

IAILFK - UNI14138 - CGFFKRKYQQLNLESTRRAQLKADSLLQD
Transcript ENSMUST00000102537
Sequence
CCCACTCAGCTCACACAGCTGCATCTGCTCCAGCTATGAAGTGGCTCTTCCATACCCTTCTCTGCATGGCCA - UNI31088 - GCCTGAAGCCCCAG

GGAGCCTTCAATTTGGATGTGGACTGGGCCTGGGTCACAGCACTCCAGCCAGGTGCACCGGCTGTGCTCAGCTCCCTTCTGCATCAAGACCCCAGCAACA

ACCAGACCTG CCTCCTGGTAGCCAGACGCAGCTCCAACAGGAATACAGCCGCCCTGTATCGATGCGCTATATCCATCAGTCCAGATGAAATTGCTTGCC

AGCCAGTGG AGCACATCTGTATGCCAAAGGGCAGGTACCAGGGAGTGACATTGGTCGGGAACCACAATGGTGTTTTG GTGTGCATTCAGGTACAGGCC

CGGAAGTTCCGCAGCCTCAACTCAGAGCTCACGGGTGCCTGCAGCCTACTCACCCCCAATTTGGACCTCCAGGCCCAAGCCTACTTCTCTGACCTCG AA

GGGTTCCTGGATCCAGGAGCACATGTGGACTCTGGTGACTACTGTAGAAGCAAAGGAGGCAGCACAGGGGAGGAGAAGAAGTCAGCCAGGAGACGCCGGA

CAGTGGAGGAGGAAGACGAGGAGGAAGATG GCACTGAGATCGCTATTGTCCTGGATGGCTCAGGAAGCATTGAACCCTCAGACTTCCAGAAGGCCAAAA

ATTTCATCTCTACCATGATGAGGAACTTCTATGAGAAGTGTTTTGAG TGCAACTTTGCCCTGGTGCAGTATGGGGCCGTGATCCAGACTGAGTTTGATC

TTCAAGAGAGCCGGGACATTAACGCCTCCCTTGCCAAAGTTCAGAGCATCGTTCAAGTGAAGGAAGTCACTAAGACCGCCTCAGCCATGCAGCATGTCCT

 AGACAATATCTTCATTCCAAGCCGTGGCTCCAGAAAAAAAGCATTGAAGGTCATGGTGGTACTTACTGATGGTGACATATTTGGGGACCCTCTCAATCT

TACGACTGTCATCAACTCCCCAAAGATGCAGGGTGTTGTGCGCTTTGCCATTGGG GTGGGTGATGCATTCAAGAATAACAACACTTACAGAGAACTGAA

GCTGATTGCCTCAGACCCCAAAGAGGCCCACACTTTCAAGGTGACCAACTACTCAGCTCTGGATGGGCTGCTGAGCAAGCTGCAACAACACATCGTTCAT

ATGGAAG GTACAGTTGGAGATGCCCTTCAATATCAACTCGCACAGACTGGTTTCAGTGCCCAGATCCTGGACAAG GGGCAGGTGTTGCTTGGCACTGT

GGGGGCCTTTAACTGGTCTGGGGGTGCGCTGCTCTACAGCACACAGAATGGCCGGGGCTGCTTCCTAAACCAGACAGCCAAGGAGGACTCCAGGACTGTA

CAGTACAGCTACCTAG GTTACTCCCTTGCGGTGCTACACAAGGCCCACGGCGTCTCTTACGTGGCAGGGGCTCCAAGGCACAAGCTCCGTGGGGCTGTG

TTTGAGCTCCGGAAGGAGGACAGAGAGGAGGATGCCTTTGTGCGACGGATAGAAGGAGAGCAG ATGGGGTCCTACTTTGGCTCTGTGCTGTGCCCTGTG

GATATCGACATGGATGGGACCACAGATTTTCTACTGGTGGCTGCTCCATTTTACCACATCCGTGGAGAAGAAGGCAGAGTCTATGTGTACCAGGTGCCTG

AGCAG GATGCTTCCTTCTCCTTGGCACACACACTGAGTGGGCACCCTGGGCTCACCAATAGCCGCTTTGGCTTTGCCATGGCAGCTGTGGGGGATATCA

ACCAAGACAAATTCACAGATGTGGCCATTGGGGCCCCTCTGGAGGGTTTTGGGGCAGGTGACGGGGCCAGCTATGGCAGCGTGTACATCTACAACGGACA

CTCAGGTGGCTTGTATGACAGTCCTTCCCAG CAGATCCGAGCCTCCTCTGTGGCCTCGGGACTCCACTACTTCGGCATGTCTGTGTCCGGTGGGTTAGA

TTTCAATGGCGATGGCCTTGCCGATATCACAGTTGGCTCTCGGGACTCGGCGGTTGTGCTCCG CTCACGCCCTGTGGTTGACCTGACCGTATCTATGAC

CTTTACCCCCGATGCACTGCCCATGGTCTTCATAGGCAAGATGGATGTAAAACTGTGTTTTGAAGTTGACTCTTCAGGCGTAGCTTCTGAGCCAG GCCT

TAGAGAGATGTTCCTCAACTTTACGGTGGATGTGGATGTGACCAAGCAAAGGCAGAGGCTGCAGTGTGAGGACTCGAGCGGTTGTCAGAGCTGCCTCAGG

AAGTGGAACGGAGGGTCCTTTCTGTGTGAACACTTCTGGCTCATCTCCACAGAGGAG CTTTGTGAGGAGGACTGCTTCTCCAACATCACCATCAAGGTC

ACCTACGAGTTCCAGACGTCTGGGGGAAGGAGGGACTACCCCAACCCCACCCTGGACCACTACAAGGAACCCTCTGCCATCTTCCAG CTGCCCTACGAG

AAGGACTGCAAGAACAAAGTGTTCTGCATCGCTGAGATCCAGCTGACCACCAACATCTCCCA GCAGGAACTGGTGGTGGGCGTCACAAAGGAGGTGACC

ATGAACATCAGCCTGACTAACTCTGGAGAGGATTCCTACATGACAAACATGGCTCTCAATTATCCCAGAAACTTACAGTTTAAGAAGATACAAAAG CCA

GTATCTCCAGATGTTCAGTGTGATGACCCCAAGCCAGTTGCTTCTGTCCTGGTCATGAACTGCAAGATTGGTCACCCCATACTCAAGAGATCATCT GTG

AATGTCTCAGTAACTTGGCAGCTAGAGGAGAGTGTCTTTCCAAATAGGACAGCAGATATCACTGTGACCATCTCCAA TTCCAATGAGAAGTCTTTGGCC

AGAGAGACACGCAGCCTTCAATTCAGACATGCCTTCATTGCAGTTCTTTCCAG ACCCTCAGTGATGTACATGAACACAAGCCAAAGCCCTTCTGACCAC

AAAGAATTCTTCTTCAAT GTGCATGGGGAGAATCTTTTTGGAGCTGTATTCCAGTTGCAAATTTGTGTCCCCATCAAATTACAAGATTTCCAGATTGTA

AGAGTGAAGAATCTGACAAAGACTCAGGTATTTAAATGGGAGTCTGTGATTGCATCGCTTTCCAAAGACTACAGATTCTCAAAGATATAA
Translation
MKWLFHTLLCMAS - UNI31088 - SLKPQGAFNLDVDWAWVTALQPGAPAVLSSLLHQDPSNNQTC CLLVARRSSNRNTAALYRCAISISPDEIAC

QPVE EHICMPKGRYQGVTLVGNHNGVL VCIQVQARKFRSLNSELTGACSLLTPNLDLQAQAYFSDLE EGFLDPGAHVDSGDYCRSKGGSTGEEKKSA

RRRRTVEEEDEEEDG GTEIAIVLDGSGSIEPSDFQKAKNFISTMMRNFYEKCFE CNFALVQYGAVIQTEFDLQESRDINASLAKVQSIVQVKEVTKTA

SAMQHVL LDNIFIPSRGSRKKALKVMVVLTDGDIFGDPLNLTTVINSPKMQGVVRFAIG VGDAFKNNNTYRELKLIASDPKEAHTFKVTNYSALDGLL

SKLQQHIVHMEG GTVGDALQYQLAQTGFSAQILDK GQVLLGTVGAFNWSGGALLYSTQNGRGCFLNQTAKEDSRTVQYSYLG GYSLAVLHKAHGVSY

VAGAPRHKLRGAVFELRKEDREEDAFVRRIEGEQ MGSYFGSVLCPVDIDMDGTTDFLLVAAPFYHIRGEEGRVYVYQVPEQ DASFSLAHTLSGHPGLT

NSRFGFAMAAVGDINQDKFTDVAIGAPLEGFGAGDGASYGSVYIYNGHSGGLYDSPSQ QIRASSVASGLHYFGMSVSGGLDFNGDGLADITVGSRDSAV

VLR RSRPVVDLTVSMTFTPDALPMVFIGKMDVKLCFEVDSSGVASEPG GLREMFLNFTVDVDVTKQRQRLQCEDSSGCQSCLRKWNGGSFLCEHFWLI

STEE LCEEDCFSNITIKVTYEFQTSGGRRDYPNPTLDHYKEPSAIFQ LPYEKDCKNKVFCIAEIQLTTNISQ QQELVVGVTKEVTMNISLTNSGEDS

YMTNMALNYPRNLQFKKIQK PVSPDVQCDDPKPVASVLVMNCKIGHPILKRSS VNVSVTWQLEESVFPNRTADITVTISN NSNEKSLARETRSLQFR

HAFIAVLSR RPSVMYMNTSQSPSDHKEFFFN VHGENLFGAVFQLQICVPIKLQDFQIVRVKNLTKTQVFKWESVIASLSKDYRFSKI

For any suggestions or comments, please send an email to unitrap@crg.es