Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000006010 (BC003331)
Chromosomal location
Chr 1: 152208443 - 152240185 (-)
Description
Protein odr-4 homolog (mODR-4) [Source:UniProtKB/Swiss-Prot;Acc:Q4PJX1]
RefSeq_dna
NM_145511 NM_001077237 
RefSeq_peptide
NP_663486.2 NP_001070705.1 
UniGene
Mm.398544 Mm.222093 
MGI
MGI:2385108 
Uniprot/SWISSPROT
Q4PJX1 
Human Ortholog
ENSG00000157181 (C1orf27)
Omim not available
UniTrap UNI16062
Vector Insertion
Chr 1: 152237487 - 152239733
Public Clones (sanger) IST14551E5 (tigm) IST14555D3 (tigm)
Private Clones OST466941 (lexicon) OST306635 (lexicon) OST287261 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111912
Sequence
AGCCACCCTCGTCCTTATCCCGGAGGAGCAAGACGACCTTACCGTCAAAACCCCGGGATGTCATGGGTACTCCTCTGTGGCCACTTCTAGAAGCCGAGCC

ACCAGAGGTCATGGGTCACGGCAGGGTGTCTCGACAGGCTCTGGGCTACCGCCACGATCTTAACGGTGCCCCGAGAGGGGCGGGGTGCAGGCCTCCCTCG

CTTGGGTAGAAGAGCTGCGGAGATGGGTGCGGGACGGCTTGCGTCATCAGTCTGCACCCGTTGGGGCCGCGACCCGCGTTTGGAGTAGGAAGTGTCTCTG

CTGTCGCTTTCTGATGAGATCATTGGCTGTGGACGTGGGGACCTGAGTGGCACCTGGCCTTTGAAG - UNI16062 - GCTGTTGAATTGGCTGTCTA

TAATGGGAAGAACCTACATTGTAGAAGAGACTGTTGGCCAGTATCTTTCAAGCATCAACCTCCAGGGAAAACCTTTTGTCTCTGGTCTTTTGATAGGACA

G TGTTCTTCACAAAAGGATTATGTGATTCTTGCCACTAGAACACCACCCAAAGAGGAACAAAATGACAAAGTCAAACAGCCGAGAGCTAAGTTGGATAA

TTTGGATGAAGAATGGGCCACAGAACATGCCAGCCAG GTGTCCAGAATGCTCCCTGGAGGACTTGTGGTTCTTGGAATATTTATTATCACAACTTTAGA

ACTAGCAGATGATTTTCAAAATGCCCTGCGCAGA CTAATATTTTCTATGGAAAAATCTATGAGTAGAAAAAGACTATGGGATGTCACAGAGGACGAGGT

CTCAGAACGAGTGACACTTCACATTTGTTCTTCTACAAAAAA AATATCTTGTCGAACTTACGATGTCCAAGATCCAAAG AGTTCAGCAAGACCCGCAG

ATTGGAAGTATCAGAGTAGAGTGTCTGCCTCATGGCTGTCTCTAGACTGTACTGTTCACGTTAACATTCACATCCCACTGTCGGCTACTTCTGTCAGTTA

CACTCTGGAAAAAAACACAAAG AGTGGACTTACACGCTGGGCCAAGCAAATAGAAAATGGTGTTTATCTGATTAATGGACAAGTTAAAGGCAACGATTG

TGACTTATTAGAAGGACAG AAAAAAAGCAGAGGAAATACGCAAGCAACTGCTCATTCTTTTGATGTCCGAGTGCTAACACAGTTG CTCCTGAATTCGG

ACCACAGATCCACAGCCACAGTCCAAATCTGCAGTGGTTCTGTAAATCTTCGGGGAAATGTGAAATGCAGAGCTTATATCCATAGCAACAGACCCAAGGT

TAAAGATGCTGTGCAG GCAGTGAAGAGAGATATTTTGAACACAGTTGCTGATCGCTGTGAAATACTCTTTGAGGACCTGCTTCTGAATGAAATTCCAGA

AAAAAAAA ATTATGAACTTCCTCAGAGAGTTTTTGTTCCCCTTCCTGGATCTACTGTAATGTTATGTGACTATAAGTTTGGTGATGAATCAGCTGAAGA

AATCAGAGACCATTTTTCAGAGATGTTAGATCATGAGATTCAAATAGAAGACTTGGAAATTGCAGAGGAAGTAAACACAG CTTGCATGACTTCCTCTGT

GAATAGTGAGGCTTCACTGACCAACACAAGTGAAGAACAACCAGAACAACCAAAA AACCATAGGAGTGAAAATTCAGCAAAACATAG GTGTGATCGCA

GCACTAGCTGTTGCAGTGCTTGCTGCGGGCATCTCCTTCCATTACTTCAGTGATTAGAGCTCCCTGATCATCCAGAAATCACGGATCAACAGCTACAGAA

AATAACGACATCAATGTCCACCTGCACTGAAGCTAGCAAGCAGCTCTGCTACGTTAACATCTGTTAGATGTGTTTCTGACTTACATGAAACCACCAGCTG

CCTTGTTTAGCCCTGCTTTGATTATCTGGCCCAGGTTTCCAAAAGTAAACTGTGCATCTAAATGGAGTTGCATGTAACAAATCACTATTATGTATTTTCA

GAAGGGTCAAAATGTGAGCTATTTAAGAGTTTAGTGCTTTCAAAAAAAAAAAAAAAAAAGTTTAGTGCTATTGAACCGGATCACACATTGATTAGAATAT

TGAAAGTTTAAGCAGACAGTAGTAACTATAGCAGATGTATCACTAGGCATTATCTTCATCCTAAAGGACTTTTCTAATATGCACCCAGTTGCCGTAGTTT

ATAGACACTGTTTAAATTGGAGGCCATGAATATTATTTTAAGCATACACATGGACTGTGGTTTCTTGGATGGCAGATCCAGTAGTAGCACTGCAGAATGC

TGTTTGCCTCAATCCAGAAAAGAGAGAAATGTAAATCTGAGATGCTATCCTAGTTAGGGAAGTTAATATTCAGCAGCTCCCCCTTGTAGTTCTGTGTAGC

TAGCTCCTGGCAGAAATAAACTAGAAACACTCCTAACTTAGGCCCAAGACTCCCATAAGTTATGATCAAGCAATATTTCTTCCTGATTCTATATCATGAG

GTACAAGATGCAGTGAGACTGGGAGAAATAAACTATAGGAAAAACACATTGAAGTCATTTCCCAAGGTTCACGTCAACAATGTAGAGAGTAACAGGTGGG

TAGAGCCACAGTGTGGGTGAAAGCCAAGTAGTGCTCCTCAGAATGAGGAGGAGAGGAAACTGTGGGCTGTTTAGTGGGAGTGGACTTGGCTGAAGAGACC

AGAGAATGGAAGGTAGAGCAGCAGGAAGGCTGGGAGGAGTGAGGAGGGACAAGGTCTAGGAGGACCAGGAGGCGGGAATGGGAGAGAGGCAGCACTTAGA

CAACAGGTTTCTGCACACTCGTTACCAAACAGGCTTATAATTGAAGAAACAAACAAACAAACAAATAATTCACAAGTGAATCAAGTATGAAACAAGGTTC

CTAAAAAGCCAAAGAGGTGATAAAGATGCCCAGCTAAGGCAACTCAGTCACATGCATAGTAGACCGGAAGCAACAGTTTACCCAAGAAGGTGGTAAAATC

TCTTCATAGTTGTGAGGGCAACTGAAAATCAGTGCAAAGTGAAACTCAGAAACAAACCGTTATTACAGAACTGAAAAAGGATGGTCCTTGATAAGAAGAA

TTCCTCAAGAAGCAAGCTTTGAAAGTGAAGTGTTAATGAGCAGACAAAACGATCAATATTGTAAATCTAAAGTGTTATTTGTATACAAAAATCATAATGA

AGTATTTAAAGAAATTGTAATAGAAATTGTAAACAAATGTAACACCGAATAAATATTGTTAATGC
Translation
 - UNI16062 - MGRTYIVEETVGQYLSSINLQGKPFVSGLLIGQ CSSQKDYVILATRTPPKEEQNDKVKQPRAKLDNLDEEWATEHASQ VSRMLP

GGLVVLGIFIITTLELADDFQNALRR LIFSMEKSMSRKRLWDVTEDEVSERVTLHICSSTKK KISCRTYDVQDPK SSARPADWKYQSRVSASWLSLD

CTVHVNIHIPLSATSVSYTLEKNTK SGLTRWAKQIENGVYLINGQVKGNDCDLLEGQ KKSRGNTQATAHSFDVRVLTQL LLNSDHRSTATVQICSGS

VNLRGNVKCRAYIHSNRPKVKDAVQ AVKRDILNTVADRCEILFEDLLLNEIPEKKN NYELPQRVFVPLPGSTVMLCDYKFGDESAEEIRDHFSEMLDH

EIQIEDLEIAEEVNTA ACMTSSVNSEASLTNTSEEQPEQPK NHRSENSAKHR RCDRSTSCCSACCGHLLPLLQ
Transcript ENSMUST00000094477
Sequence
GATGAGATCATTGGCTGTGGACGTGGGGACCTGAGTGGCACCTGGCCTTTGAAGGTAGCTACTTGTACCCTAACTCGAGTTCTCTCGCTGACAGAAAGCT

CCAGGGATTTATTTGCCACATGTGCACATTCTGAGATCAA - UNI16062 - GCTGTTGAATTGGCTGTCTATAATGGGAAGAACCTACATTGTAGAA

GAGACTGTTGGCCAGTATCTTTCAAGCATCAACCTCCAGGGAAAACCTTTTGTCTCTGGTCTTTTGATAGGACAG TGTTCTTCACAAAAGGATTATGTG

ATTCTTGCCACTAGAACACCACCCAAAGAGGAACAAAATGACAAAGTCAAACAGCCGAGAGCTAAGTTGGATAATTTGGATGAAGAATGGGCCACAGAAC

ATGCCAGCCAG GTGTCCAGAATGCTCCCTGGAGGACTTGTGGTTCTTGGAATATTTATTATCACAACTTTAGAACTAGCAGATGATTTTCAAAATGCCC

TGCGCAGA CTAATATTTTCTATGGAAAAATCTATGAGTAGAAAAAGACTATGGGATGTCACAGAGGACGAGGTCTCAGAACGAGTGACACTTCACATTT

GTTCTTCTACAAAAAA AATATCTTGTCGAACTTACGATGTCCAAGATCCAAAG AGTTCAGCAAGACCCGCAGATTGGAAGTATCAGAGTAGAGTGTCT

GCCTCATGGCTGTCTCTAGACTGTACTGTTCACGTTAACATTCACATCCCACTGTCGGCTACTTCTGTCAGTTACACTCTGGAAAAAAACACAAAG AGT

GGACTTACACGCTGGGCCAAGCAAATAGAAAATGGTGTTTATCTGATTAATGGACAAGTTAAAGGCAACGATTGTGACTTATTAGAAGGACAG AAAAAA

AGCAGAGGAAATACGCAAGCAACTGCTCATTCTTTTGATGTCCGAGTGCTAACACAGTTG CTCCTGAATTCGGACCACAGATCCACAGCCACAGTCCAA

ATCTGCAGTGGTTCTGTAAATCTTCGGGGAAATGTGAAATGCAGAGCTTATATCCATAGCAACAGACCCAAGGTTAAAGATGCTGTGCAG GCAGTGAAG

AGAGATATTTTGAACACAGTTGCTGATCGCTGTGAAATACTCTTTGAGGACCTGCTTCTGAATGAAATTCCAGAAAAAAAAA ATTATGAACTTCCTCAG

AGAGTTTTTGTTCCCCTTCCTGGATCTACTGTAATGTTATGTGACTATAAGTTTGGTGATGAATCAGCTGAAGAAATCAGAGACCATTTTTCAGAGATGT

TAGATCATGAGATTCAAATAGAAGACTTGGAAATTGCAGAGGAAGTAAACACAG CTTGCATGACTTCCTCTGTGAATAGTGAGGCTTCACTGACCAACA

CAAGTGAAGAACAACCAGAACAACCAAAAAAAACCATAGGAGTGAAAATTCAGCAAAACATAG GTGTGATCGCAGCACTAGCTGTTGCAGTGCTTGCTG

CGGGCATCTCCTTCCATTACTTCAGTGATTAGAGCTCCCTGATCATCCAGAAATCACGGATCAACAGCTACAGAAAATAACGACATCAATGTCCACCTGC

ACTGAAGCTAGCAAGCAGCTCTGCTACGTTAACATCTGTTAGATGTGTTTCTGACTTACATGAAACCACCAGCTGCCTTGTTTAGCCCTGCTTTGATTAT

CTGGCCCAGGTTTCCAAAAGTAAACTGTGCATCTAAATGGAGTTGCATGTAACAAATCACTATTATGTATTTTCAGAAGGGTCAAAATGTGAGCTATTTA

AGAGTTTAGTGCTTTCAAA
Translation
 - UNI16062 - MGRTYIVEETVGQYLSSINLQGKPFVSGLLIGQ CSSQKDYVILATRTPPKEEQNDKVKQPRAKLDNLDEEWATEHASQ VSRMLP

GGLVVLGIFIITTLELADDFQNALRR LIFSMEKSMSRKRLWDVTEDEVSERVTLHICSSTKK KISCRTYDVQDPK SSARPADWKYQSRVSASWLSLD

CTVHVNIHIPLSATSVSYTLEKNTK SGLTRWAKQIENGVYLINGQVKGNDCDLLEGQ KKSRGNTQATAHSFDVRVLTQL LLNSDHRSTATVQICSGS

VNLRGNVKCRAYIHSNRPKVKDAVQ AVKRDILNTVADRCEILFEDLLLNEIPEKKN NYELPQRVFVPLPGSTVMLCDYKFGDESAEEIRDHFSEMLDH

EIQIEDLEIAEEVNTA ACMTSSVNSEASLTNTSEEQPEQPKKTIGVKIQQNIG GVIAALAVAVLAAGISFHYFSD
Transcript ENSMUST00000097546
Sequence
AGCCACCCTCGTCCTTATCCCGGAGGAGCAAGACGACCTTACCGTCAAAACCCCGGGATGTCATGGGTACTCCTCTGTGGCCACTTCTAGAAGCCGAGCC

ACCAGAGGTCATGGGTCACGGCAGGGTGTCTCGACAGGCTCTGGGCTACCGCCACGATCTTAACGGTGCCCCGAGAGGGGCGGGGTGCAGGCCTCCCTCG

CTTGGGTAGAAGAGCTGCGGAGATGGGTGCGGGACGGCTTGCGTCATCAGTCTGCACCCGTTGGGGCCGCGACCCGCGTTTGGAGTAGGAAGTGTCTCTG

CTGTCGCTTTCTGATGAGATCATTGGCTGTGGACGTGGGGACCTGAGTGGCACCTGGCCTTTGAAG - UNI16062 - GCTGTTGAATTGGCTGTCTA

TAATGGGAAGAACCTACATTGTAGAAGAGACTGTTGGCCAGTATCTTTCAAGCATCAACCTCCAGGGAAAACCTTTTGTCTCTGGTCTTTTGATAGGACA

G TGTTCTTCACAAAAGGATTATGTGATTCTTGCCACTAGAACACCACCCAAAGAGGAACAAAATGACAAAGTCAAACAGCCGAGAGCTAAGTTGGATAA

TTTGGATGAAGAATGGGCCACAGAACATGCCAGCCAG GTGTCCAGAATGCTCCCTGGAGGACTTGTGGTTCTTGGAATATTTATTATCACAACTTTAGA

ACTAGCAGATGATTTTCAAAATGCCCTGCGCAGA CTAATATTTTCTATGGAAAAATCTATGAGTAGAAAAAGACTATGGGATGTCACAGAGGACGAGGT

CTCAGAACGAGTGACACTTCACATTTGTTCTTCTACAAAAAA AATATCTTGTCGAACTTACGATGTCCAAGATCCAAAG AGTTCAGCAAGACCCGCAG

ATTGGAAGTATCAGAGTAGAGTGTCTGCCTCATGGCTGTCTCTAGACTGTACTGTTCACGTTAACATTCACATCCCACTGTCGGCTACTTCTGTCAGTTA

CACTCTGGAAAAAAACACAAAG AGTGGACTTACACGCTGGGCCAAGCAAATAGAAAATGGTGTTTATCTGATTAATGGACAAGTTAAAGGCAACGATTG

TGACTTATTAGAAGGACAG CTCCTGAATTCGGACCACAGATCCACAGCCACAGTCCAAATCTGCAGTGGTTCTGTAAATCTTCGGGGAAATGTGAAATG

CAGAGCTTATATCCATAGCAACAGACCCAAGGTTAAAGATGCTGTGCAG GCAGTGAAGAGAGATATTTTGAACACAGTTGCTGATCGCTGTGAAATACT

CTTTGAGGACCTGCTTCTGAATGAAATTCCAGAAAAAAAAA ATTATGAACTTCCTCAGAGAGTTTTTGTTCCCCTTCCTGGATCTACTGTAATGTTATG

TGACTATAAGTTTGGTGATGAATCAGCTGAAGAAATCAGAGACCATTTTTCAGAGATGTTAGATCATGAGATTCAAATAGAAGACTTGGAAATTGCAGAG

GAAGTAAACACAG CTTGCATGACTTCCTCTGTGAATAGTGAGGCTTCACTGACCAACACAAGTGAAGAACAACCAGAACAACCAAAAAAAACCATAGGA

GTGAAAATTCAGCAAAACATAG GTGTGATCGCAGCACTAGCTGTTGCAGTGCTTGCTGCGGGCATCTCCTTCCATTACTTCAGTGATTAGAGCTCCCTG

ATCATCCAGAAATCACGGATCAACAGCTACAGAAAATAACGACATCAATGTCCACCTGCACTGAAGCTAGCAAGCAGCTCTGCTACGTTAACATCTGTTA

GATGTGTTTCTGACTTACATGAAACCACCAGCTGCCTTGTTTAGCCCTGCTTTGATTATCTGGCCCAGGTTTCCAAAAGTAAACTGTGCATCTAAATGGA

GTTGCATGTAACAAATCACTATTATGTATTTTCAGAAGGGTCAAAATGTGAGCTATTTAAGAGTTTAGTGCTTTCAAAAAAAAAAAAAAAAAAGTTTAGT

GCTATTGAACCGGATCACACATTGATTAGAATATTGAAAGTTTAAGCAGACAGTAGTAACTATAGCAGATGTATCACTAGGCATTATCTTCATCCTAAAG

GACTTTTCTAATATGCACCCAGTTGCCGTAGTTTATAGACACTGTTTAAATTGGAGGCCATGAATATTATTTTAAGCATACACATGGACTGTGGTTTCTT

GGATGGCAGATCCAGTAGTAGCACTGCAGAATGCTGTTTGCCTCAATCCAGAAAAGAGAGAAATGTAAATCTGAGATGCTATCCTAGTTAGGGAAGTTAA

TATTCAGCAGCTCCCCCTTGTAGTTCTGTGTAGCTAGCTCCTGGCAGAAATAAACTAGAAACACTCCTAACTTAGGCCCAAGACTCCCATAAGTTATGAT

CAAGCAATATTTCTTCCTGATTCTATATCATGAGGTACAAGATGCAGTGAGACTGGGAGAAATAAACTATAGGAAAAACACATTGAAGTCATTTCCCAAG

GTTCACGTCAACAATGTAGAGAGTAACAGGTGGGTAGAGCCACAGTGTGGGTGAAAGCCAAGTAGTGCTCCTCAGAATGAGGAGGAGAGGAAACTGTGGG

CTGTTTAGTGGGAGTGGACTTGGCTGAAGAGACCAGAGAATGGAAGGTAGAGCAGCAGGAAGGCTGGGAGGAGTGAGGAGGGACAAGGTCTAGGAGGACC

AGGAGGCGGGAATGGGAGAGAGGCAGCACTTAGACAACAGGTTTCTGCACACTCGTTACCAAACAGGCTTATAATTGAAGAAACAAACAAACAAACAAAT

AATTCACAAGTGAATCAAGTATGAAACAAGGTTCCTAAAAAGCCAAAGAGGTGATAAAGATGCCCAGCTAAGGCAACTCAGTCACATGCATAGTAGACCG

GAAGCAACAGTTTACCCAAGAAGGTGGTAAAATCTCTTCATAGTTGTGAGGGCAACTGAAAATCAGTGCAAAGTGAAACTCAGAAACAAACCGTTATTAC

AGAACTGAAAAAGGATGGTCCTTGATAAGAAGAATTCCTCAAGAAGCAAGCTTTGAAAGTGAAGTGTTAATGAGCAGACAAAACGATCAATATTGTAAAT

CTAAAGTGTTATTTGTATACAAAAATCATAATGAAGTATTTAAAGAAATTGTAATAGAAATTGTAAACAAATGTAACACCGAATAAATATTGTTAATGC
Translation
 - UNI16062 -   MLPGGLVVLGIFIITTLELADDFQNALRR LIFSMEKSMSRKRLWDVTEDEVSERVTLHICSSTKK KISCRTYDVQDPK SSA

RPADWKYQSRVSASWLSLDCTVHVNIHIPLSATSVSYTLEKNTK SGLTRWAKQIENGVYLINGQVKGNDCDLLEGQ LLNSDHRSTATVQICSGSVNLR

GNVKCRAYIHSNRPKVKDAVQ AVKRDILNTVADRCEILFEDLLLNEIPEKKN NYELPQRVFVPLPGSTVMLCDYKFGDESAEEIRDHFSEMLDHEIQI

EDLEIAEEVNTA ACMTSSVNSEASLTNTSEEQPEQPKKTIGVKIQQNIG GVIAALAVAVLAAGISFHYFSD
Transcript ENSMUST00000006167
Sequence
GGGGACCTGAGTGGCACCTGGCCTTTGAAGGTAGCTACTTGTACCCTAACTCGAGTTCTCTCGCTGACAGAAAGCTCCAGGGATTTATTTGCCACATGTG

CACATTCTGAGATCAA - UNI16062 - GCTGTTGAATTGGCTGTCTATAATGGGAAGAACCTACATTGTAGAAGAGACTGTTGGCCAGTATCTTTCA

AGCATCAACCTCCAGGGAAAACCTTTTGTCTCTGGTCTTTTGATAGGACAG TGTTCTTCACAAAAGGATTATGTGATTCTTGCCACTAGAACACCACCC

AAAGAGGAACAAAATGACAAAGTCAAACAGCCGAGAGCTAAGTTGGATAATTTGGATGAAGAATGGGCCACAGAACATGCCAGCCAG GTGTCCAGAATG

CTCCCTGGAGGACTTGTGGTTCTTGGAATATTTATTATCACAACTTTAGAACTAGCAGATGATTTTCAAAATGCCCTGCGCAGA CTAATATTTTCTATG

GAAAAATCTATGAGTAGAAAAAGACTATGGGATGTCACAGAGGACGAGGTCTCAGAACGAGTGACACTTCACATTTGTTCTTCTACAAAAAA AATATCT

TGTCGAACTTACGATGTCCAAGATCCAAAG AGTTCAGCAAGACCCGCAGATTGGAAGTATCAGAGTAGAGTGTCTGCCTCATGGCTGTCTCTAGACTGT

ACTGTTCACGTTAACATTCACATCCCACTGTCGGCTACTTCTGTCAGTTACACTCTGGAAAAAAACACAAAG AGTGGACTTACACGCTGGGCCAAGCAA

ATAGAAAATGGTGTTTATCTGATTAATGGACAAGTTAAAGGCAACGATTGTGACTTATTAGAAGGACAG CTCCTGAATTCGGACCACAGATCCACAGCC

ACAGTCCAAATCTGCAGTGGTTCTGTAAATCTTCGGGGAAATGTGAAATGCAGAGCTTATATCCATAGCAACAGACCCAAGGTTAAAGATGCTGTGCAG 

GCAGTGAAGAGAGATATTTTGAACACAGTTGCTGATCGCTGTGAAATACTCTTTGAGGACCTGCTTCTGAATGAAATTCCAGAAAAAAAAA ATTATGAA

CTTCCTCAGAGAGTTTTTGTTCCCCTTCCTGGATCTACTGTAATGTTATGTGACTATAAGTTTGGTGATGAATCAGCTGAAGAAATCAGAGACCATTTTT

CAGAGATGTTAGATCATGAGATTCAAATAGAAGACTTGGAAATTGCAGAGGAAGTAAACACAG CTTGCATGACTTCCTCTGTGAATAGTGAGGCTTCAC

TGACCAACACAAGTGAAGAACAACCAGAACAACCAAAAAAAACCATAGGAGTGAAAATTCAGCAAAACATAG GTGTGATCGCAGCACTAGCTGTTGCAG

TGCTTGCTGCGGGCATCTCCTTCCATTACTTCAGTGATTAGAGCTCCCTGATCATCCAGAAATCACGGATCAACAGCTACAGAAAATAACGACATCAATG

TCCACCTGCACTGAAGCTAGCAAGCAGCTCTGCTACGTTAACATCTGTTAGATGTGTTTCTGACTTACATGAAACCACCAGCTGCCTTGTTTAGCCCTGC

TTTGATTATCTGGCCCAGGTTTCCAAAAGTAAACTGTGCATCTAAATGGAGTTGCATGTAACAAATCACTATTATGTATTTTCAGAAGGGTCAAAATGTG

AGCTATTTAAGAGTTTAGTGCTTTCAAAAAAAAAAAAAAAA
Translation
 - UNI16062 - MGRTYIVEETVGQYLSSINLQGKPFVSGLLIGQ CSSQKDYVILATRTPPKEEQNDKVKQPRAKLDNLDEEWATEHASQ VSRMLP

GGLVVLGIFIITTLELADDFQNALRR LIFSMEKSMSRKRLWDVTEDEVSERVTLHICSSTKK KISCRTYDVQDPK SSARPADWKYQSRVSASWLSLD

CTVHVNIHIPLSATSVSYTLEKNTK SGLTRWAKQIENGVYLINGQVKGNDCDLLEGQ LLNSDHRSTATVQICSGSVNLRGNVKCRAYIHSNRPKVKDA

VQ AVKRDILNTVADRCEILFEDLLLNEIPEKKN NYELPQRVFVPLPGSTVMLCDYKFGDESAEEIRDHFSEMLDHEIQIEDLEIAEEVNTA ACMTSS

VNSEASLTNTSEEQPEQPKKTIGVKIQQNIG GVIAALAVAVLAAGISFHYFSD
Transcript ENSMUST00000097547
Sequence
AGCCACCCTCGTCCTTATCCCGGAGGAGCAAGACGACCTTACCGTCAAAACCCCGGGATGTCATGGGTACTCCTCTGTGGCCACTTCTAGAAGCCGAGCC

ACCAGAGGTCATGGGTCACGGCAGGGTGTCTCGACAGGCTCTGGGCTACCGCCACGATCTTAACGGTGCCCCGAGAGGGGCGGGGTGCAGGCCTCCCTCG

CTTGGGTAGAAGAGCTGCGGAGATGGGTGCGGGACGGCTTGCGTCATCAGTCTGCACCCGTTGGGGCCGCGACCCGCGTTTGGAGTAGGAAGTGTCTCTG

CTGTCGCTTTCTGATGAGATCATTGGCTGTGGACGTGGGGACCTGAGTGGCACCTGGCCTTTGAAG - UNI16062 - GCTGTTGAATTGGCTGTCTA

TAATGGGAAGAACCTACATTGTAGAAGAGACTGTTGGCCAGTATCTTTCAAGCATCAACCTCCAGGGAAAACCTTTTGTCTCTGGTCTTTTGATAGGACA

G TGTTCTTCACAAAAGGATTATGTGATTCTTGCCACTAGAACACCACCCAAAGAGGAACAAAATGACAAAGTCAAACAGCCGAGAGCTAAGTTGGATAA

TTTGGATGAAGAATGGGCCACAGAACATGCCAGCCAG GTGTCCAGAATGCTCCCTGGAGGACTTGTGGTTCTTGGAATATTTATTATCACAACTTTAGA

ACTAGCAGATGATTTTCAAAATGCCCTGCGCAGA CTAATATTTTCTATGGAAAAATCTATGAGTAGAAAAAGACTATGGGATGTCACAGAGGACGAGGT

CTCAGAACGAGTGACACTTCACATTTGTTCTTCTACAAAAAA AATATCTTGTCGAACTTACGATGTCCAAGATCCAAAG AGTTCAGCAAGACCCGCAG

ATTGGAAGTATCAGAGTAGAGTGTCTGCCTCATGGCTGTCTCTAGACTGTACTGTTCACGTTAACATTCACATCCCACTGTCGGCTACTTCTGTCAGTTA

CACTCTGGAAAAAAACACAAAG AAAAAAAGCAGAGGAAATACGCAAGCAACTGCTCATTCTTTTGATGTCCGAGTGCTAACACAGTTG CTCCTGAATT

CGGACCACAGATCCACAGCCACAGTCCAAATCTGCAGTGGTTCTGTAAATCTTCGGGGAAATGTGAAATGCAGAGCTTATATCCATAGCAACAGACCCAA

GGTTAAAGATGCTGTGCAG GCAGTGAAGAGAGATATTTTGAACACAGTTGCTGATCGCTGTGAAATACTCTTTGAGGACCTGCTTCTGAATGAAATTCC

AGAAAAAAAAA ATTATGAACTTCCTCAGAGAGTTTTTGTTCCCCTTCCTGGATCTACTGTAATGTTATGTGACTATAAGTTTGGTGATGAATCAGCTGA

AGAAATCAGAGACCATTTTTCAGAGATGTTAGATCATGAGATTCAAATAGAAGACTTGGAAATTGCAGAGGAAGTAAACACAG CTTGCATGACTTCCTC

TGTGAATAGTGAGGCTTCACTGACCAACACAAGTGAAGAACAACCAGAACAACCAAAAAAAACCATAGGAGTGAAAATTCAGCAAAACATAG GTGTGAT

CGCAGCACTAGCTGTTGCAGTGCTTGCTGCGGGCATCTCCTTCCATTACTTCAGTGATTAGAGCTCCCTGATCATCCAGAAATCACGGATCAACAGCTAC

AGAAAATAACGACATCAATGTCCACCTGCACTGAAGCTAGCAAGCAGCTCTGCTACGTTAACATCTGTTAGATGTGTTTCTGACTTACATGAAACCACCA

GCTGCCTTGTTTAGCCCTGCTTTGATTATCTGGCCCAGGTTTCCAAAAGTAAACTGTGCATCTAAATGGAGTTGCATGTAACAAATCACTATTATGTATT

TTCAGAAGGGTCAAAATGTGAGCTATTTAAGAGTTTAGTGCTTTCAAAAAAAAAAAAAAAAAAGTTTAGTGCTATTGAACCGGATCACACATTGATTAGA

ATATTGAAAGTTTAAGCAGACAGTAGTAACTATAGCAGATGTATCACTAGGCATTATCTTCATCCTAAAGGACTTTTCTAATATGCACCCAGTTGCCGTA

GTTTATAGACACTGTTTAAATTGGAGGCCATGAATATTATTTTAAGCATACACATGGACTGTGGTTTCTTGGATGGCAGATCCAGTAGTAGCACTGCAGA

ATGCTGTTTGCCTCAATCCAGAAAAGAGAGAAATGTAAATCTGAGATGCTATCCTAGTTAGGGAAGTTAATATTCAGCAGCTCCCCCTTGTAGTTCTGTG

TAGCTAGCTCCTGGCAGAAATAAACTAGAAACACTCCTAACTTAGGCCCAAGACTCCCATAAGTTATGATCAAGCAATATTTCTTCCTGATTCTATATCA

TGAGGTACAAGATGCAGTGAGACTGGGAGAAATAAACTATAGGAAAAACACATTGAAGTCATTTCCCAAGGTTCACGTCAACAATGTAGAGAGTAACAGG

TGGGTAGAGCCACAGTGTGGGTGAAAGCCAAGTAGTGCTCCTCAGAATGAGGAGGAGAGGAAACTGTGGGCTGTTTAGTGGGAGTGGACTTGGCTGAAGA

GACCAGAGAATGGAAGGTAGAGCAGCAGGAAGGCTGGGAGGAGTGAGGAGGGACAAGGTCTAGGAGGACCAGGAGGCGGGAATGGGAGAGAGGCAGCACT

TAGACAACAGGTTTCTGCACACTCGTTACCAAACAGGCTTATAATTGAAGAAACAAACAAACAAACAAATAATTCACAAGTGAATCAAGTATGAAACAAG

GTTCCTAAAAAGCCAAAGAGGTGATAAAGATGCCCAGCTAAGGCAACTCAGTCACATGCATAGTAGACCGGAAGCAACAGTTTACCCAAGAAGGTGGTAA

AATCTCTTCATAGTTGTGAGGGCAACTGAAAATCAGTGCAAAGTGAAACTCAGAAACAAACCGTTATTACAGAACTGAAAAAGGATGGTCCTTGATAAGA

AGAATTCCTCAAGAAGCAAGCTTTGAAAGTGAAGTGTTAATGAGCAGACAAAACGATCAATATTGTAAATCTAAAGTGTTATTTGTATACAAAAATCATA

ATGAAGTATTTAAAGAAATTGTAATAGAAATTGTAAACAAATGTAACACCGAATAAATATTGTTAATGC
Translation
 - UNI16062 - MGRTYIVEETVGQYLSSINLQGKPFVSGLLIGQ CSSQKDYVILATRTPPKEEQNDKVKQPRAKLDNLDEEWATEHASQ VSRMLP

GGLVVLGIFIITTLELADDFQNALRR LIFSMEKSMSRKRLWDVTEDEVSERVTLHICSSTKK KISCRTYDVQDPK SSARPADWKYQSRVSASWLSLD

CTVHVNIHIPLSATSVSYTLEKNTK KKSRGNTQATAHSFDVRVLTQL LLNSDHRSTATVQICSGSVNLRGNVKCRAYIHSNRPKVKDAVQ AVKRDIL

NTVADRCEILFEDLLLNEIPEKKN NYELPQRVFVPLPGSTVMLCDYKFGDESAEEIRDHFSEMLDHEIQIEDLEIAEEVNTA ACMTSSVNSEASLTNT

SEEQPEQPKKTIGVKIQQNIG GVIAALAVAVLAAGISFHYFSD
Transcript ENSMUST00000111913
Sequence
AGCCACCCTCGTCCTTATCCCGGAGGAGCAAGACGACCTTACCGTCAAAACCCCGGGATGTCATGGGTACTCCTCTGTGGCCACTTCTAGAAGCCGAGCC

ACCAGAGGTCATGGGTCACGGCAGGGTGTCTCGACAGGCTCTGGGCTACCGCCACGATCTTAACGGTGCCCCGAGAGGGGCGGGGTGCAGGCCTCCCTCG

CTTGGGTAGAAGAGCTGCGGAGATGGGTGCGGGACGGCTTGCGTCATCAGTCTGCACCCGTTGGGGCCGCGACCCGCGTTTGGAGTAGGAAGTGTCTCTG

CTGTCGCTTTCTGATGAGATCATTGGCTGTGGACGTGGGGACCTGAGTGGCACCTGGCCTTTGAAG - UNI16062 - GCTGTTGAATTGGCTGTCTA

TAATGGGAAGAACCTACATTGTAGAAGAGACTGTTGGCCAGTATCTTTCAAGCATCAACCTCCAGGGAAAACCTTTTGTCTCTGGTCTTTTGATAGGACA

G TGTTCTTCACAAAAGGATTATGTGATTCTTGCCACTAGAACACCACCCAAAGAGGAACAAAATGACAAAGTCAAACAGCCGAGAGCTAAGTTGGATAA

TTTGGATGAAGAATGGGCCACAGAACATGCCAGCCAG GTGTCCAGAATGCTCCCTGGAGGACTTGTGGTTCTTGGAATATTTATTATCACAACTTTAGA

ACTAGCAGATGATTTTCAAAATGCCCTGCGCAGA CTAATATTTTCTATGGAAAAATCTATGAGTAGAAAAAGACTATGGGATGTCACAGAGGACGAGGT

CTCAGAACGAGTGACACTTCACATTTGTTCTTCTACAAAAAA AATATCTTGTCGAACTTACGATGTCCAAGATCCAAAG AGTTCAGCAAGACCCGCAG

ATTGGAAGTATCAGAGTAGAGTGTCTGCCTCATGGCTGTCTCTAGACTGTACTGTTCACGTTAACATTCACATCCCACTGTCGGCTACTTCTGTCAGTTA

CACTCTGGAAAAAAACACAAAG AGTGGACTTACACGCTGGGCCAAGCAAATAGAAAATGGTGTTTATCTGATTAATGGACAAGTTAAAGGCAACGATTG

TGACTTATTAGAAGGACAG AAAAAAAGCAGAGGAAATACGCAAGCAACTGCTCATTCTTTTGATGTCCGAGTGCTAACACAGTTG CTCCTGAATTCGG

ACCACAGATCCACAGCCACAGTCCAAATCTGCAGTGGTTCTGTAAATCTTCGGGGAAATGTGAAATGCAGAGCTTATATCCATAGCAACAGACCCAAGGT

TAAAGATGCTGTGCAG GCAGTGAAGAGAGATATTTTGAACACAGTTGCTGATCGCTGTGAAATACTCTTTGAGGACCTGCTTCTGAATGAAATTCCAGA

AAAAAAAA ATTATGAACTTCCTCAGAGAGTTTTTGTTCCCCTTCCTGGATCTACTGTAATGTTATGTGACTATAAGTTTGGTGATGAATCAGCTGAAGA

AATCAGAGACCATTTTTCAGAGATGTTAGATCATGAGATTCAAATAGAAGACTTGGAAATTGCAGAGGAAGTAAACACAG CTTGCATGACTTCCTCTGT

GAATAGTGAGGCTTCACTGACCAACACAAGTGAAGAACAACCAGAACAACCAAAAAAAACCATAGGAGTGAAAATTCAGCAAAACATAG GTGTGATCGC

AGCACTAGCTGTTGCAGTGCTTGCTGCGGGCATCTCCTTCCATTACTTCAGTGATTAGAGCTCCCTGATCATCCAGAAATCACGGATCAACAGCTACAGA

AAATAACGACATCAATGTCCACCTGCACTGAAGCTAGCAAGCAGCTCTGCTACGTTAACATCTGTTAGATGTGTTTCTGACTTACATGAAACCACCAGCT

GCCTTGTTTAGCCCTGCTTTGATTATCTGGCCCAGGTTTCCAAAAGTAAACTGTGCATCTAAATGGAGTTGCATGTAACAAATCACTATTATGTATTTTC

AGAAGGGTCAAAATGTGAGCTATTTAAGAGTTTAGTGCTTTCAAAAAAAAAAAAAAAAAAGTTTAGTGCTATTGAACCGGATCACACATTGATTAGAATA

TTGAAAGTTTAAGCAGACAGTAGTAACTATAGCAGATGTATCACTAGGCATTATCTTCATCCTAAAGGACTTTTCTAATATGCACCCAGTTGCCGTAGTT

TATAGACACTGTTTAAATTGGAGGCCATGAATATTATTTTAAGCATACACATGGACTGTGGTTTCTTGGATGGCAGATCCAGTAGTAGCACTGCAGAATG

CTGTTTGCCTCAATCCAGAAAAGAGAGAAATGTAAATCTGAGATGCTATCCTAGTTAGGGAAGTTAATATTCAGCAGCTCCCCCTTGTAGTTCTGTGTAG

CTAGCTCCTGGCAGAAATAAACTAGAAACACTCCTAACTTAGGCCCAAGACTCCCATAAGTTATGATCAAGCAATATTTCTTCCTGATTCTATATCATGA

GGTACAAGATGCAGTGAGACTGGGAGAAATAAACTATAGGAAAAACACATTGAAGTCATTTCCCAAGGTTCACGTCAACAATGTAGAGAGTAACAGGTGG

GTAGAGCCACAGTGTGGGTGAAAGCCAAGTAGTGCTCCTCAGAATGAGGAGGAGAGGAAACTGTGGGCTGTTTAGTGGGAGTGGACTTGGCTGAAGAGAC

CAGAGAATGGAAGGTAGAGCAGCAGGAAGGCTGGGAGGAGTGAGGAGGGACAAGGTCTAGGAGGACCAGGAGGCGGGAATGGGAGAGAGGCAGCACTTAG

ACAACAGGTTTCTGCACACTCGTTACCAAACAGGCTTATAATTGAAGAAACAAACAAACAAACAAATAATTCACAAGTGAATCAAGTATGAAACAAGGTT

CCTAAAAAGCCAAAGAGGTGATAAAGATGCCCAGCTAAGGCAACTCAGTCACATGCATAGTAGACCGGAAGCAACAGTTTACCCAAGAAGGTGGTAAAAT

CTCTTCATAGTTGTGAGGGCAACTGAAAATCAGTGCAAAGTGAAACTCAGAAACAAACCGTTATTACAGAACTGAAAAAGGATGGTCCTTGATAAGAAGA

ATTCCTCAAGAAGCAAGCTTTGAAAGTGAAGTGTTAATGAGCAGACAAAACGATCAATATTGTAAATCTAAAGTGTTATTTGTATACAAAAATCATAATG

AAGTATTTAAAGAAATTGTAATAGAAATTGTAAACAAATGTAACACCGAATAAATATTGTTAATGC
Translation
 - UNI16062 - MGRTYIVEETVGQYLSSINLQGKPFVSGLLIGQ CSSQKDYVILATRTPPKEEQNDKVKQPRAKLDNLDEEWATEHASQ VSRMLP

GGLVVLGIFIITTLELADDFQNALRR LIFSMEKSMSRKRLWDVTEDEVSERVTLHICSSTKK KISCRTYDVQDPK SSARPADWKYQSRVSASWLSLD

CTVHVNIHIPLSATSVSYTLEKNTK SGLTRWAKQIENGVYLINGQVKGNDCDLLEGQ KKSRGNTQATAHSFDVRVLTQL LLNSDHRSTATVQICSGS

VNLRGNVKCRAYIHSNRPKVKDAVQ AVKRDILNTVADRCEILFEDLLLNEIPEKKN NYELPQRVFVPLPGSTVMLCDYKFGDESAEEIRDHFSEMLDH

EIQIEDLEIAEEVNTA ACMTSSVNSEASLTNTSEEQPEQPKKTIGVKIQQNIG GVIAALAVAVLAAGISFHYFSD

For any suggestions or comments, please send an email to unitrap@crg.es