Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000006056 (Calcoco2)
Chromosomal location
Chr 11: 95960640 - 95973276 (-)
Description
calcium binding and coiled-coil domain 2 Gene [Source:MGI (curated);Acc:Calcoco2-001]
RefSeq_peptide
NP_001093647.1 NP_084031.2 
UniGene
Mm.459602 Mm.473635 Mm.296049 Mm.465168 
MGI
MGI:1343177 
Uniprot/SWISSPROT
A2A6M5 
Human Ortholog
ENSG00000136436 (CALCOCO2)
Omim not available
UniTrap UNI15585
Vector Insertion
Chr 11: 95968744 - 95973277
Public Clones CMHD-GT_488D1-3 (cmhd) PST2894-NR (escells) IST14744D3 (tigm) IST15000E4 (tigm)
IST10247B11 (tigm) IST14994G11 (tigm) IST10703A3 (tigm) IST14822C6 (tigm)
Private Clones OST465789 (lexicon) OST457227 (lexicon) OST434526 (lexicon) OST393944 (lexicon)
OST375937 (lexicon) OST354310 (lexicon) OST346043 (lexicon) OST338607 (lexicon)
OST299718 (lexicon) OST289783 (lexicon) OST265350 (lexicon) OST265092 (lexicon)
OST262982 (lexicon) OST251804 (lexicon) OST251396 (lexicon) OST250740 (lexicon)
OST248791 (lexicon) OST234024 (lexicon) OST224307 (lexicon) OST207450 (lexicon)
OST207403 (lexicon) OST202757 (lexicon) OST202334 (lexicon) OST195176 (lexicon)
OST169682 (lexicon) OST165260 (lexicon) OST155089 (lexicon) OST151114 (lexicon)
OST127175 (lexicon) OST125060 (lexicon) OST109341 (lexicon) OST101537 (lexicon)
OST99272 (lexicon) OST92149 (lexicon) OST90823 (lexicon) OST69579 (lexicon)
OST31091 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24477
Vector Insertion
Chr 11: 95964875 - 95968744
Public Clones not available
Private Clones OST218511 (lexicon) OST210054 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20149
Vector Insertion
Chr 11: 95964665 - 95964771
Public Clones not available
Private Clones OST371357 (lexicon) OST251620 (lexicon) OST215499 (lexicon) OST182833 (lexicon)
OST170485 (lexicon) OST361 (lexicon)
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000097162
Sequence
GCTAGTGCTGCTGGCTGCTGTTCCTG - UNI15585 - GACTTCACCATGGACCAGTGCCCCATACCTACCTTGCTGGAACATGGCAACTTCTCTCAG

GTCCTGTTTAACAATGTGGAGAAGTTCTATGCTCCTAGAGGAGATATCATGTGCTATTACACCCTCACTGAAAAGTTCATCCCTCGACGCAAGGACTGGA

TTGGCATCTTTAAA - UNI15585 - - UNI24477 - GTAGGGTGGAAGACCACTCAGGAGTATTATACCTTCATGTGGGCTCCCTTGCCAAAAGA

CCAAAACAAGGATTCAGCCACACAGCAGGAAATCCAATTCAAAG - UNI20149 - CTTATTACCTTCCCAAGGATGTGGAGCGCTACCAGTTCTGCT

ATGTGGATGAAGATGGTTTAGTCCGGGGAACAAGTGTCCCTTTCCAGTTTTGTCCAGACCCTGACGAGGACATAATGGTTGTTATCAATAAG GAAAAGG

TAGAAGAGATGGAACAGCTCAGTGAGGAGCTTTACCAACAAAACCAGGAGCTGAAAGACAAGTACGCTGACCTCCATGAGCAGCTACAGAGGAAGCAG G

TGGCACTGGAAGCAACACAGAGGGTCAATAAGACCTTAGAACACAAAGTGGAAGAGAAGGCCTCCTGGGAGAAAGAGAAGGCCTCCTGGGAGGAAGAGAA

GGCCTCCTGGGAGGAAGAGAAGGCCTCCTGGGAGGAAGAGAAGGCCTCCTGGGAG GAAGTGAAGGCCTATTGGTGGAATGATCTGCACCGGTGAGTGGG

GGAAGGGCCACTCACTGTTAGCACTGCCTGTTCTGGTTTGGTATGATTGCACATCCCAGACTGAGGACCAGAAGTTTAAGGCCATCCTTAGCTACACAGT

GAATCTGAGGCCAGCGTAGGCTACATGATGGCCTGTCCCAAAACAAAACAAAGAAACCCCTGTCTCAAAAGGACTCAGCCAAGTGGTCGTGCACACCTTT

AATCTCAGCACTAGGGAAGCTGGGACAGAAGGATTGCCCCAGTTCGGGATAAATAGTAGCTGGCCAGACAGCTATATAGCAAGACCCTATTTCAGAAACC

AAAGAAAGGAGAAAAAATTGATTGTTAAATGTGGTTGTATGATTTTAAACCCACTAGAAGATGTACTTTGATATGTGTGTGTATCCTGGGTACCCTCTGA

GCTCAGAGAGGGTATCAGGTCTCTGAAACTGGAGTTACAGAGTTATGAGCTAGGTACCAAACCTGAGTCCTGTGCAAGAGCATCAAGTGCTCTTCACTTT

TGAGCCATCCCTCCAACCATAAATTAACTTTACATTCATACATTTTGTGCTGTGTTGATTTTATAAAGTCATATTTGTATTTT
Translation
 - UNI15585 - MDQCPIPTLLEHGNFSQVLFNNVEKFYAPRGDIMCYYTLTEKFIPRRKDWIGIFK - UNI15585 - - UNI24477 - VGWK

TTQEYYTFMWAPLPKDQNKDSATQQEIQFKA - UNI20149 - AYYLPKDVERYQFCYVDEDGLVRGTSVPFQFCPDPDEDIMVVINK EKVEEMEQL

SEELYQQNQELKDKYADLHEQLQRKQ VALEATQRVNKTLEHKVEEKASWEKEKASWEEEKASWEEEKASWEEEKASWE EVKAYWWNDLHR
Transcript ENSMUST00000068686
Sequence
GCTAGTGCTGCTGGCTGCTGTTCCTG - UNI15585 - GACTTCACCATGGACCAGTGCCCCATACCTACCTTGCTGGAACATGGCAACTTCTCTCAG

GTCCTGTTTAACAATGTGGAGAAGTTCTATGCTCCTAGAGGAGATATCATGTGCTATTACACCCTCACTGAAAAGTTCATCCCTCGACGCAAGGACTGGA

TTGGCATCTTTAAA - UNI15585 - - UNI24477 - GTAGGGTGGAAGACCACTCAGGAGTATTATACCTTCATGTGGGCTCCCTTGCCAAAAGA

CCAAAACAAGGATTCAGCCACACAGCAGGAAATCCAATTCAAAG - UNI20149 - CTTATTACCTTCCCAAGGATGTGGAGCGCTACCAGTTCTGCT

ATGTGGATGAAGATGGTTTAGTCCGGGGAACAAGTGTCCCTTTCCAGTTTTGTCCAGACCCTGACGAGGACATAATGGTTGTTATCAATAAG GAAAAGG

TAGAAGAGATGGAACAGCTCAGTGAGGAGCTTTACCAACAAAACCAGGAGCTGAAAGACAAGTACGCTGACCTCCATGAGCAGCTACAGAGGAAGCAG G

TGGCACTGGAAGCAACACAGAGGGTCAATAAGACCTTAGAACACAAAGTGGAAGAGAAGGCCTCCTGGGAGAAAGAGAAGGCCTCCTGGGAGGAAGAGAA

GGCCTCCTGGGAGGAAGAGAAGGCCTCCTGGGAGGAAGAGAAGGCCTCCTGGGAGGAAGAGAAGGCCTCCTGGGAGGAAGAGAAGGCCTCCTGGGAGGAA

GAGAAGGCCTCCTGGGAGGAAGAGAAGGCCTCCTGGGAGGAAGAGAAGGCCTCCTGGGAGGAAGAGAAGGCCTCCTGGGAGGAAGAGAAGGCCTCCTGGG

AGGAAGAGAAGGCCTCCTGGGAGGAAGAGAAGGCCTCCTGGGAGGAAGAGAAGGCCTCCTGGGAGAAAGAGAAGGCCTCCTGGGAGGAAGAGAAGGCCTC

CTGGGAGAAAGAGAAGGCCCCCTGGGAGGTAGAGAAGGCCCCCTGGAAGGAAGTGAAGGCCTATTGGTGGAATGATCTGCACCGGTGA
Translation
 - UNI15585 - MDQCPIPTLLEHGNFSQVLFNNVEKFYAPRGDIMCYYTLTEKFIPRRKDWIGIFK - UNI15585 - - UNI24477 - VGWK

TTQEYYTFMWAPLPKDQNKDSATQQEIQFKA - UNI20149 - AYYLPKDVERYQFCYVDEDGLVRGTSVPFQFCPDPDEDIMVVINK EKVEEMEQL

SEELYQQNQELKDKYADLHEQLQRKQ VALEATQRVNKTLEHKVEEKASWEKEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWE

EEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEEEKASWEKEKASWEEEKASWEKEKAPWEVEKAPWKEVKAYWWNDLHR
Transcript ENSMUST00000006215
Sequence
GCTAGTGCTGCTGGCTGCTGTTCCTG - UNI15585 - GACTTCACCATGGACCAGTGCCCCATACCTACCTTGCTGGAACATGGCAACTTCTCTCAG

GTCCTGTTTAACAATGTGGAGAAGTTCTATGCTCCTAGAGGAGATATCATGTGCTATTACACCCTCACTGAAAAGTTCATCCCTCGACGCAAGGACTGGA

TTGGCATCTTTAAA - UNI15585 - - UNI24477 - GTAGGGTGGAAGACCACTCAGGAGTATTATACCTTCATGTGGGCTCCCTTGCCAAAAGA

CCAAAACAAGGATTCAGCCACACAGCAGGAAATCCAATTCAAAG - UNI20149 - CTTATTACCTTCCCAAGGATGTGGAGCGCTACCAGTTCTGCT

ATGTGGATGAAGATGGTTTAGTCCGGGGAACAAGTGTCCCTTTCCAGTTTTGTCCAGACCCTGACGAGGACATAATGGTTGTTATCAATAAG GAAAAGG

TAGAAGAGATGGAACAGCTCAGTGAGGAGCTTTACCAACAAAACCAGGAGCTGAAAGACAAGTACGCTGACCTCCATGAGCAGCTACAGAGGAAGCAG G

TGGCACTGGAAGCAACACAGAGGGTCAATAAGACCTTAGAACACAAAGTGGAAGAGAAGGCCTCCTGG AGAAAGAGAAGGCCTCCTGGGAGGAAGAGAA

GGCCTCCTGGGAGGAAGAGAAGGCCTCCTGGGAGG
Translation
 - UNI15585 - MDQCPIPTLLEHGNFSQVLFNNVEKFYAPRGDIMCYYTLTEKFIPRRKDWIGIFK - UNI15585 - - UNI24477 - VGWK

TTQEYYTFMWAPLPKDQNKDSATQQEIQFKA - UNI20149 - AYYLPKDVERYQFCYVDEDGLVRGTSVPFQFCPDPDEDIMVVINK EKVEEMEQL

SEELYQQNQELKDKYADLHEQLQRKQ VALEATQRVNKTLEHKVEEKASW RKRRPPGRKRRPPGRKRRPPGR

For any suggestions or comments, please send an email to unitrap@crg.es