Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000006169 (Clint1)
Chromosomal location
Chr 11: 45665501 - 45724127 (+)
Description
clathrin interactor 1 Gene [Source:MGI (curated);Acc:Clint1-002]
RefSeq_dna
NM_001045520 
RefSeq_peptide
NP_001038985.2 
UniGene
Mm.169673 Mm.475268 
MGI
MGI:2144243 
Uniprot/SWISSPROT
Q99KN9 
Uniprot/SPTREMBL
Q3TJF5 Q3UGL3 Q3UPG6 Q5SUH7 Q5SUH6 
Human Ortholog
ENSG00000113282 (CLINT1)
Omim 181500 - SCHIZOPHRENIA  181510 - SCHIZOPHRENIA 1  
UniTrap UNI1428
Vector Insertion
Chr 11: 45665695 - 45695724
Public Clones (sanger) CG0731 (sanger) 3SD136C04 (ggtc) 5SD136C04 (ggtc) IST11516D7 (tigm)
IST12934E12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30178
Vector Insertion
Chr 11: 45697931 - 45699932
Public Clones (sanger) D090E01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30260
Vector Insertion
Chr 11: 45700042 - 45700887
Public Clones D054H12 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9734
Vector Insertion
Chr 11: 45707620 - 45708561
Public Clones XG131 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI479
Vector Insertion
Chr 11: 45708632 - 45715712
Public Clones DB0077 (sanger) YTA282 (baygenomics) CSI492 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6825
Vector Insertion
Chr 11: 45715788 - 45719682
Public Clones RHA181 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109259
Sequence
TTGGAGGGGGTGTCCCTGGCATTCAGGGGACACTTTTCTTGGTAGAGTCCTGTTGTGGGTGTCGGTGTAGGAGCTGCACTGTTTGTTCTGTGACCTGACC

AACTGTCTATATGTGACTGTCTCAGTGCTGATGTGGATCTGTTTGTCAGTGACTTAACTAAGCTAAACTCCTTGAAGGAACGAATGGCAGCAGACAAGGT

CTAAAAGCGCTGAGCCTTGATCCTTCCGTATTTAGAAAACAACTTTTGATGACTTTTAAAAAGCCACATAGCAAAAGAAGGGAGGATATATGAGTAGTAG

CTATCTAAATCTGATTTTATTCACTCATTTATTAGTTTTGATTTTGTGTTGCTGTGTTCATCTGTTAGAACACACATTCAGTAGTAATGGGAACTATATA

CATCAGATGAACTCACATTTTTATGGCTTTTCTTCCTTCAGATCCCATACACATGGCTGTTTAAAAAAAAAAAATCAAGTGTTTTGCTGTCTTGTGTCTT

ACCCTTTGAAAGCGTTCTTTCTTGCTATAGGATGGCTCTCAGTTATTAACTGAGCATCACCTGTCTGTCAGGCAGGAGAGCAGCACCAGTTTCTATGCTG

TCTTTTGAGGTGTACAGAGCCTCTTCCCAGTCTACAGTTGAAACCAAGGTTAAAACAAAACTGCTTCATGAAATGGGGTTGGAATCAGGTTTTCTGTCTC

CCATGTTCTTGTCAAAAAACTAGAAGTCTCAAGGAAAAGTTAAATATCATTTCCCAGTAAAATATTATGTAGCCAGTGAAGGTGTGAGGTTTACAATAAC

TAATAATTAAGTTTTTGTTAGAGAAAAACACTGATACAGAAGGAAATGTTGGTAATAGTTTTAAACAGTTGTAGAATATTCTCTTTGTGTTATGTCTTTT

TTAAATGTCACACAGAATTGTCCACTGTAATTTAGTGTAAGAGAACAGAATTCCTATAAACACAAACCCGACCTCTTGTAAAGCACGGGCAGAGAGAAGG

TGAACATCCTGGCTCTGTGATAGACTTGAGCGTGTCCGTTTGTCTTTGAGATCAGACCATGTCTCCTGGACTTGGGCCAGGGCTGATGACATTCCTCTGC

ATTCTTGAAAGCTAAATTCTTAAGATAACTTAAGTGTGTAATGTCGTGTCTTTGGAGTAGCCTGTGAGCAGAGCTGCCCCCCACTCCATAGATGTGGCTC

ATTAAGACATACGTTAGTATCATTTAGTTTTCATGTGTTGCTCAGTTTTGATGCTAATCTTTATGTATCTATATGTGTGTGTGTGCACATGCACATGTGC

ATTTTCCCTCTGCAGCACCAATGTGGTTATGAATTACTCAGAGATTGAGTCTAAGGTTCGAGAAGCAACGAATGATGATCCCTGGGGACCTTCTGGGCAG

CTCATGGGAGAGATTGCCAA GGCTACCTTTATGTATGAGCAGTTCCCAGAACTCATGAACATGCTTTGGTCCCGGATGCTAAAAGACAACAAAAAGAAC

TGGAGAAGAGTTTATAAG - UNI30178 - TCGTTGCTGCTCCTAGCTTACCTCATAAGAAATGGATCGGAGCGAGTTGTTACAAGTGCCAGAGAACA

CATTTATGATTTGCGATCCCTGGAAAATTACCACTTTGTAG - UNI30260 - ATGAGCATGGCAAGGATCAAGGTATAAACATTCGACAGAAAGTAA

AGGAACTGGTTGAGTTTGCACAGGATGATGACAGGCTTCGAGAAGAGCGAAAGAAAGCAAAGAAGAACAAAGACAAGTATGTCGGGGTCTCTTCAGACAG

CGTTGGTGGATTCCGATACA ATGAGCGGTACGATCCTGAGCCCAAGTCCAAATGGGACGAAGAGTGGGATAAGAACAAGAGCGCGTTTCCGTTCAGTGA

CAAGCTGGGCGAGCTGAGCGACAAGATCGGGAGCACGATCGACGACACCATCAGCAAGTTCCGGAGGAAAGACCGGGAGGACTCTCCGGAAAGGTGCAG 

CGACAGTGATGAGGAAAAGAAAGCAAGAAGAGGTAGATCTCCCAAAGGTGAATTCAAAGATGAAGAGGAAACGGTGACGACGAAGCATATCCACATCACA

CAGGCCACAGAGACCACCACAACCCGGCACAAGCGCACAGCAAACCCTTCCAAAACCATTGATCTTGGAGCAGCAGCACATTACACGGGGGACAAAGCCA

GCCCAGATCAGAATGCTTCAACCCACACGCCTCAGTCGTCAGCCAAG - UNI9734 - CCATCGGTGCCGAGCAGCAAGTCCTCGGGGGACCTCGTTG

ACCTGTTTGATGGCAGTAGCCAGTCAGCAG - UNI479 - - UNI6825 - CAACAAGTGGGAATGGTGACTTTGGTGACTGGAGTGCCTTCAACCA

AGCCCCATCAGGCCCTGTGGCTTCTGGTGGTGAGCTCTTCGGCAGTGCCCCACAGTCGGCTGTGGAGCTTATCAGTGCTTCACAGCCAGCTTTAGGCCCA

CCGCCTGCTGCCTCAAACTCGGCAGACCTGTTTGATCTTATGGGCTCATCCCAGGCAACCATGACGTCTTCCCAGAGCATGAATTTCTCTCTCATGAGCA

CTAACACCGTGGGACTTGGTTTGCCCATGTCCAGATCACAGGTAAGTTGTCTGTTTCCCTTGGGAATTGGTGCTTACACTAGTACTAGAAGGTCTAATAG

CATGATGAGTTAGTGTAAGACAACACGGACTGACTCCTCCCCCACCCCATAGTCCAGTGTGGGCTAAACACTGTTAGGTGACACAGGACTGCACGTGACA

TGCTGTAGGTTGCACTTTTCACCCATTGGGTCTTTTATGTGTTCTAGAAGGCAGGGTAGTCTTACCTATTTACAGTCCCTGGCACAGAGAGATGTGCTGA

AGTCTTGTGGGTTACCACAATTAGTATTTAGTTGTGTTTAAACATTGATTTGGGGGAATAGATTTGCTGTGTGACTCATGGAAACTAGTTAATAAACTCT

GCTTTGTCGGGATGGTTTTGTGTCGCTGTGCGTTGATGTTCAAGTAGAAAATCCAGTGATGGATGAAACCTGTTCCCGGCTTGTTGGCAACCTTCATTTT

AACACAGGGAAACTTGTGAGAGGTTTCTAATTCACACTTTAAATAAGAGTTAAGATTTTTGCATAACAGTATCTTAGACTTGAACATAGTTGGAAAATGA

GTTGTACTTGGGGGTTTGCTAGCTATGGCTGAGTCACTGATAGGTTTCTATGCTAATCCCTTGTTTTAATGTATAGATCCTCGTCTTTGGGGTATTGGGA

CGAAGGAAGGGAAGAAAGAAGCAGAGCGGTGACTGAGAGGCCAGCGGCCTTCTTTCAGCCACTGTGTCCTCCAGCACTTCGCCTTGGTAGACTTCTCATT

TCTTGTCACCCATTCCTTTTTTCTGTCCCTTTAAAAGTCATTTTTAGCAGCCACCATGCACCTCTGCTTCTTTCTCCTGAATTCCTTCTATCAGTCCACA

TGTGTTTCCTGAGCCACTGATGGTGCCCACTCGAGGCAGTGGAGGTGCACAGAGCCAGGAAATGCCAGTCAGGCCCTGGGACGGCCATTTGCCGCTTGAT

GACTTGGGCTTTATGCCATGAGCAGACAGAGTTGCATTCCGCCTGTCCTCCGGCTTCAGTTGTGTTCACCCAGCTGGTGGGTCTCTGCTCCCTGTCCAGG

CACTGCCCTTTGCTTTCTGCTCAGTAACTCTGTTTTCCTGAGGTGGGTAGCCATAGTAACCTGAAGTTGGTCATTGTCCAGGGCATTTGTCAGAGATGGT

GGCTTCTACAGGACTGAGCATTAGATTATGGGATCATACCCAAGTCTTCAGAAGGCCTTGTTTAAGACCAGAGGTGGGTCAGTGAGTGGGATGGAAATAA

AGTATCTTGGCATTGAAGTCTTAGTATAAGGCACCCGTGGTTATCTGATGAAGTTGTCGTCTGATACCTGAGCAGCTGCTACTTCATTTCCGGAGCATCC

TTTTCTCTTCCAGCCTCTGCAGAATGTTAGTGCAGTGCTGCAGAAGCCTAACCCTCTCTATCATCAGAATACAGATATGGTCCAGAAGTCGGCCAGCAAA

ACCCTGCCCTCTACTTGGTCTGACCCCAGTGTCAACATCAGCCTAGACAACTTACTACCTGGTATGCAGCCTTCCAAGCCCCAGCAGCCATCGCTTAATA

CAATGATTCAACAACAGAGTAAGTCACCTCAAATGCCCCCGCCTGGGCTTCATAGATTTTTACCCTGACTACAGGACTTCTTTAAGTATTAAAGTAATAA

TAGATGAACACACTGGGGATAGGTAGGGATGTATGTGAAGGTAACCGTATTCACCTAAGATCTTTCTGCTTCGTGTTGACACCCTTCCCACTGGCACGCT

GACTCTGTACTGTGCTTCTGGTTGTGATATGACCTGTGAGTTCAAGGACAGCGAGATGTAACTCAAGGACTAGCTCTTGCCTAGCATCCCTACAGCAGCA

GACTCTCCACCGTGCTCCAAAACAAAAAGTGGTTTTTCCCAGAATCACCATACAGCGATGTTTGCAAACCATGTGAACTCCCTAGCACAGGGCCCCTGCC

TCATGGCTGTTCTTTTATCTCGAGATGCTGAGGGGTGGATGGATGTCTGTGCTGTGATCTTTCTTGCTCTTCCCACTTAATGATATAAATATAAGGGATT

CTTTTCCTGTGTCAGAGAAAAATGACTTTTAGATTATCCCCTCATACCAGTGTACAGCTTCCCTTGTTGGTCATTTAAATTATTTTCAGCTTTTTAAACT

ACAAATAGATTTAAATTTGTATACATTCTGTACGTTTACTTTTCCTTCTTACAACTCTCTGAGTCAAAGAATATAAACTTTTTAAGGCATTTGGTAGACC

CTGACTGTGGACCATTTATTGGGTCAGCAATGGATTTTGTAGGAATGTTTTTGGGTCATGTTTCTCCCACTCTTGCTGTTTCTACATCTCTAGGTGACCA

GGCCAACATCCACTGAATATTTGTTGAGTGTAATCAGGGCAGATTAATTGACTTATTGGATATTGACAAGTCAGAAAAACCTGAAGTCAGTTTTTTTCTC

CTTTCTTCTTGTAGATATGCAACAGCCTCTGAATGTGATGACACAAAGCTTTGGAGCTGTGAACCTCAGTTCTCCATCAAACATGCTTCCTGTCCGGCCT

CAAACTAACCCTCTCCTGGGGGGACCCATGCCTATGAACATGCCCGGTGTAATGACGGGCACCATGGGAATGGCCCCTCTGGGGAACAGCGCAGGGATGA

GCCAGGGCATGGTGGGCATGAACATGAACATGGGGATGTCGGCCTCGGGGATGGGCTTGTCGGGCACCATGGGAATGGGCATGCCCAGCATGGCCATGCC

TTCTGGAACTGTGCAACCCAAGCAAGATGCCTTTGCAAACTTTGCCAACTTTAGCAAATAAAAGGTTGTAACGGAGCGAGTGGAAGAAGACTCTGTAACT

GCAATAGGTGATGTTGGGATGGAAGATGCTAAGCAGTTCCCTTTTCTTTTATCAGTTAATTAAATAACCCACATAAAGAACCAAAAAGGCTGGTGTTTCA

GAAGCGATGCAAGAGCACTTCAGATGAGGCAGTCAGGATCGGTTTCCCCAGTGAAGATACGCTCCAAATGGGGTGAGGGTCACGAGAGCCTCTCTGGGTC

AGAGAGCCCATGTCACAGCGTAGTCTGTGGGAGGACTGGCACGGATGGGGCTGAGTGTGTGTGCTTCACTCTCTAACTTTATACTTCTTTCTCCCTGAGG

AACTTGATTTTTCTGTCCCTCAATCGCCTTGTCATGATTGGGTCTGTTCCTTTACTACCACTCTCAAGTCCATAGATGAAATCATTAAAGTTGGATGATC

AGTTTTTTATAAAAATATATATTTTTGTCCAAAAAAAAGGCATACATATGTGATTATGGCTAAATCAGAGGTAACTGGATGTGTGTGCTTTTGCCAAGAC

TCCAGCAGTGCTGCTAACTACCATCTGAGTTTCCATGGATTTGACCCCTCTTCCGCAGGCAGCTGGCAGTAGCTGTGAGACTTCGCCCGTGTCTCCTGCA

GTTACCCTGTGCAGAACTGGGAAGCCTTTCTTGGGACTGCTCGGCGGTTTCCTTTAACAGTCGGAGAAGGAAGACTCGTGTGTTGTCTGTCTGTAGCGGT

TGTTCACTGCCTTTGCAGTGACTGACTTGGCAAAGCTGTTTCCTGTGCGTAGCCTTGTAGCCATCATTCAAGTCAGAAACAGTCAAAAGAGAAAAATATT

TATTTTTATCTTTTTTGGTGTCTTTTCAAAAAATTGAAAGGTAAAACTACATTAAAACCTTAAGTTAAATGTACATGTTAGGACTCAGCAATTTCACATT

TAGATTTTATACTGTATTCATTTTGTTTGCGTTTTGAGTGTGTAATACCGCATTAGCAATATGGTTCCAATAGAAGTTCGATATATATTATTAAAGGAGA

CCTGTAGCAGTCAGAGATTTTATTGATTTAATGACAAATAAAGGAAATTAATTAATTTTTTTTCCTGCTGTGATACTGCATTAAGCTCACATGAAAATCA

TGATGCTAGAGTTTGGAATGCAAAATTAAATGTTTCAACCTCAAGCTGGGAATATTTTTTAAAATAAATACTATAAGTATCAAATTATTACCTCCCCTAC

TTTATGTTGAAATTTTTTTTATTGAATTGATACAACTTTGTTTCCATTGTATTCATGATGTTCTGTTCTATATAACATTAAAACATTCATTAAAACC
Translation
MLIFMYLYVCVCTCTCAFSLCSTNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAK KATFMYEQFPELMNMLWSRMLKDNKKNWRRVYK - UNI301

78 - SLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVD - UNI30260 - DEHGKDQGINIRQKVKELVEFAQDDDRLREERKKAKKNKDKYVG

VSSDSVGGFRYN NERYDPEPKSKWDEEWDKNKSAFPFSDKLGELSDKIGSTIDDTISKFRRKDREDSPERCS SDSDEEKKARRGRSPKGEFKDEEETV

TTKHIHITQATETTTTRHKRTANPSKTIDLGAAAHYTGDKASPDQNASTHTPQSSAK - UNI9734 - PSVPSSKSSGDLVDLFDGSSQSAA - UNI

479 - - UNI6825 - ATSGNGDFGDWSAFNQAPSGPVASGGELFGSAPQSAVELISASQPALGPPPAASNSADLFDLMGSSQATMTSSQSMNFSLMS

TNTVGLGLPMSRSQVSCLFPLGIGAYTSTRRSNSMMS
Transcript ENSMUST00000065062
Sequence
ATTGTTGATAAAAA CACCAATGTGGTTATGAATTACTCAGAGATTGAGTCTAAGGTTCGAGAAGCAACGAATGATGATCCCTGGGGACCTTCTGGGCAG

CTCATGGGAGAGATTGCCAA GGCTACCTTTATGTATGAGCAGTTCCCAGAACTCATGAACATGCTTTGGTCCCGGATGCTAAAAGACAACAAAAAGAAC

TGGAGAAGAGTTTATAAG - UNI30178 - TCGTTGCTGCTCCTAGCTTACCTCATAAGAAATGGATCGGAGCGAGTTGTTACAAGTGCCAGAGAACA

CATTTATGATTTGCGATCCCTGGAAAATTACCACTTTGTAG - UNI30260 - ATGAGCATGGCAAGGATCAAGGTATAAACATTCGACAGAAAGTAA

AGGAACTGGTTGAGTTTGCACAGGATGATGACAGGCTTCGAGAAGAGCGAAAGAAAGCAAAGAAGAACAAAGACAAGTATGTCGGGGTCTCTTCAGACAG

CGTTGGTGGATTCCGATACA ATGAGCGGTACGATCCTGAGCCCAAGTCCAAATGGGACGAAGAGTGGGATAAGAACAAGAGCGCGTTTCCGTTCAGTGA

CAAGCTGGGCGAGCTGAGCGACAAGATCGGGAGCACGATCGACGACACCATCAGCAAGTTCCGGAGGAAAGACCGGGAGGACTCTCCGGAAAGGTGCAG 

CGACAGTGATGAGGAAAAGAAAGCAAGAAGAGGTAGATCTCCCAAAGGTGAATTCAAAGATGAAGAGGAAACGGTGACGACGAAGCATATCCACATCACA

CAGGCCACAGAGACCACCACAACCCGGCACAAGCGCACAGCAAACCCTTCCAAAACCATTGATCTTGGAGCAGCAGCACATTACACGGGGGACAAAGCCA

GCCCAGATCAGAATGCTTCAACCCACACGCCTCAGTCGTCAGCCAAG - UNI9734 - CCATCGGTGCCGAGCAGCAAGTCCTCGGGGGACCTCGTTG

ACCTGTTTGATGGCAGTAGCCAGTCAGCAG - UNI479 - GTGGATCAGCTGATTTATTTGGGGGATTTGCTGACTTTGGCTCAGCTGCTGCATCAGG

CAATTTCCCTTCCCAAG - UNI6825 - CAACAAGTGGGAATGGTGACTTTGGTGACTGGAGTGCCTTCAACCAAGCCCCATCAGGCCCTGTGGCTTC

TGGTGGTGAGCTCTTCGGCAGTGCCCCACAGTCGGCTGTGGAGCTTATCAGTGCTTCACAGCCAGCTTTAGGCCCACCGCCTGCTGCCTCAAACTCGGCA

GACCTGTTTGATCTTATGGGCTCATCCCAGGCAACCATGACGTCTTCCCAGAGCATGAATTTCTCTCTCATGAGCACTAACACCGTGGGACTTGGTTTGC

CCATGTCCAGATCACAG AATACAGATATGGTCCAGAAGTCGGCCAGCAAAACCCTGCCCTCTACTTGGTCTGACCCCAGTGTCAACATCAGCCTAGACA

ACTTACTACCTGGTATGCAGCCTTCCAAGCCCCAGCAGCCATCGCTTAATACAATGATTCAACAACAGA ATATGCAACAGCCTCTGAATGTGATGACAC

AAAGCTTTGGAGCTGTGAACCTCAGTTCTCCATCAAACATGCTTCCTGTCCGGCCTCAAACTAACCCTCTCCTGGGGGGACCCATGCCTATGAACATGCC

CGGTGTAATGACGGGCACCATGGGAATGGCCCCTCTGGGGAACAGCGCAGGGATGAGCCAGGGCATGGTGGGCATGAACATGAACATGGGGATGTCGGCC

TCGGGGATGGGCTTGTCGGGCACCATGGGAATGGGCATGCCCAGCATGGCCATGCCTTCTGGAACTGTGCAACCCAAGCAAGATGCCTTTGCAAACTTTG

CCAACTTTAGCAAATAAAAGGTTGTAACGG
Translation
IVDKN NTNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAK KATFMYEQFPELMNMLWSRMLKDNKKNWRRVYK - UNI30178 - SLLLLAYLIR

NGSERVVTSAREHIYDLRSLENYHFVD - UNI30260 - DEHGKDQGINIRQKVKELVEFAQDDDRLREERKKAKKNKDKYVGVSSDSVGGFRYN NE

RYDPEPKSKWDEEWDKNKSAFPFSDKLGELSDKIGSTIDDTISKFRRKDREDSPERCS SDSDEEKKARRGRSPKGEFKDEEETVTTKHIHITQATETTT

TRHKRTANPSKTIDLGAAAHYTGDKASPDQNASTHTPQSSAK - UNI9734 - PSVPSSKSSGDLVDLFDGSSQSAG - UNI479 - GGSADLFGG

FADFGSAAASGNFPSQA - UNI6825 - ATSGNGDFGDWSAFNQAPSGPVASGGELFGSAPQSAVELISASQPALGPPPAASNSADLFDLMGSSQATM

TSSQSMNFSLMSTNTVGLGLPMSRSQ NTDMVQKSASKTLPSTWSDPSVNISLDNLLPGMQPSKPQQPSLNTMIQQQN NMQQPLNVMTQSFGAVNLSSP

SNMLPVRPQTNPLLGGPMPMNMPGVMTGTMGMAPLGNSAGMSQGMVGMNMNMGMSASGMGLSGTMGMGMPSMAMPSGTVQPKQDAFANFANFSK
Transcript ENSMUST00000109260
Sequence
GGCGGCGGCGACCCGGACCTGGACCAGCCCCGGCGCGGAGGCGTCCCGGGGTCCGTGGAGAGTGGCGGCGGGCGGCGGCGGGCCGGGCCGCGCGGGGCGC

GATGCTGAACATGTGGAAGGTGCGGGAGCTGGTGGACAAAGC - UNI1428 - CACCAATGTGGTTATGAATTACTCAGAGATTGAGTCTAAGGTTCG

AGAAGCAACGAATGATGATCCCTGGGGACCTTCTGGGCAGCTCATGGGAGAGATTGCCAA GGCTACCTTTATGTATGAGCAGTTCCCAGAACTCATGAA

CATGCTTTGGTCCCGGATGCTAAAAGACAACAAAAAGAACTGGAGAAGAGTTTATAAG - UNI30178 - TCGTTGCTGCTCCTAGCTTACCTCATAA

GAAATGGATCGGAGCGAGTTGTTACAAGTGCCAGAGAACACATTTATGATTTGCGATCCCTGGAAAATTACCACTTTGTAG - UNI30260 - ATGAG

CATGGCAAGGATCAAGGTATAAACATTCGACAGAAAGTAAAGGAACTGGTTGAGTTTGCACAGGATGATGACAGGCTTCGAGAAGAGCGAAAGAAAGCAA

AGAAGAACAAAGACAAGTATGTCGGGGTCTCTTCAGACAGCGTTGGTGGATTCCGATACA ATGAGCGGTACGATCCTGAGCCCAAGTCCAAATGGGACG

AAGAGTGGGATAAGAACAAGAGCGCGTTTCCGTTCAGTGACAAGCTGGGCGAGCTGAGCGACAAGATCGGGAGCACGATCGACGACACCATCAGCAAGTT

CCGGAGGAAAGACCGGGAGGACTCTCCGGAAAGGTGCAG CGACAGTGATGAGGAAAAGAAAGCAAGAAGAGGTAGATCTCCCAAAGGTGAATTCAAAGA

TGAAGAGGAAACGGTGACGACGAAGCATATCCACATCACACAGGCCACAGAGACCACCACAACCCGGCACAAGCGCACAGCAAACCCTTCCAAAACCATT

GATCTTGGAGCAGCAGCACATTACACGGGGGACAAAGCCAGCCCAGATCAGAATGCTTCAACCCACACGCCTCAGTCGTCAGCCAAG - UNI9734 - 

CCATCGGTGCCGAGCAGCAAGTCCTCGGGGGACCTCGTTGACCTGTTTGATGGCAGTAGCCAGTCAGCAG - UNI479 - GTGGATCAGCTGATTTAT

TTGGGGGATTTGCTGACTTTGGCTCAGCTGCTGCATCAGGCAATTTCCCTTCCCAAG - UNI6825 - CAACAAGTGGGAATGGTGACTTTGGTGACT

GGAGTGCCTTCAACCAAGCCCCATCAGGCCCTGTGGCTTCTGGTGGTGAGCTCTTCGGCAGTGCCCCACAGTCGGCTGTGGAGCTTATCAGTGCTTCACA

GCCAGCTTTAGGCCCACCGCCTGCTGCCTCAAACTCGGCAGACCTGTTTGATCTTATGGGCTCATCCCAGGCAACCATGACGTCTTCCCAGAGCATGAAT

TTCTCTCTCATGAGCACTAACACCGTGGGACTTGGTTTGCCCATGTCCAGATCACAG AATACAGATATGGTCCAGAAGTCGGCCAGCAAAACCCTGCCC

TCTACTTGGTCTGACCCCAGTGTCAACATCAGCCTAGACAACTTACTACCTGGTATGCAGCCTTCCAAGCCCCAGCAGCCATCGCTTAATACAATGATTC

AACAACAGA ATATGCAACAGCCTCTGAATGTGATGACACAAAGCTTTGGAGCTGTGAACCTCAGTTCTCCATCAAACATGCTTCCTGTCCGGCCTCAAA

CTAACCCTCTCCTGGGGGGACCCATGCCTATGAACATGCCCGGTGTAATGACGGGCACCATGGGAATGGCCCCTCTGGGGAACAGCGCAGGGATGAGCCA

GGGCATGGTGGGCATGAACATGAACATGGGGATGTCGGCCTCGGGGATGGGCTTGTCGGGCACCATGGGAATGGGCATGCCCAGCATGGCCATGCCTTCT

GGAACTGTGCAACCCAAGCAAGATGCCTTTGCAAACTTTGCCAACTTTAGCAAATAAAAGGTTGTAACGGAGCGAGTGGAAGAAGACTCTGTAACTGCAA

TAGGTGATGTTGGGATGGAAGATGCTAAGCAGTTCCCTTTTCTTTTATCAGTTAATTAAATAACCCACATAAAGAACCAAAAAGGCTGGTGTTTCAGAAG

CGATGCAAGAGCACTTCAGATGAGGCAGTCAGGATCGGTTTCCCCAGTGAAGATACGCTCCAAATGGGGTGAGGGTCACGAGAGCCTCTCTGGGTCAGAG

AGCCCATGTCACAGCGTAGTCTGTGGGAGGACTGGCACGGATGGGGCTGAGTGTGTGTGCTTCACTCTCTAACTTTATACTTCTTTCTCCCTGAGGAACT

TGATTTTTCTGTCCCTCAATCGCCTTGTCATGATTGGGTCTGTTCCTTTACTACCACTCTCAAGTCCATAGATGAAATCATTAAAGTTGGATGATCAGTT

TTTTATAAAAATATATATTTTTGTCCAAAAAAAAGGCATACATATGTGATTATGGCTAAATCAGAGGTAACTGGATGTGTGTGCTTTTGCCAAGACTCCA

GCAGTGCTGCTAACTACCATCTGAGTTTCCATGGATTTGACCCCTCTTCCGCAGGCAGCTGGCAGTAGCTGTGAGACTTCGCCCGTGTCTCCTGCAGTTA

CCCTGTGCAGAACTGGGAAGCCTTTCTTGGGACTGCTCGGCGGTTTCCTTTAACAGTCGGAGAAGGAAGACTCGTGTGTTGTCTGTCTGTAGCGGTTGTT

CACTGCCTTTGCAGTGACTGACTTGGCAAAGCTGTTTCCTGTGCGTAGCCTTGTAGCCATCATTCAAGTCAGAAACAGTCAAAAGAGAAAAATATTTATT

TTTATCTTTTTTGGTGTCTTTTCAAAAAATTGAAAGGTAAAACTACATTAAAACCTTAAGTTAAATGTACATGTTAGGACTCAGCAATTTCACATTTAGA

TTTTATACTGTATTCATTTTGTTTGCGTTTTGAGTGTGTAATACCGCATTAGCAATATGGTTCCAATAGAAGTTCGATATATATTATTAAAGGAGACCTG

TAGCAGTCAGAGATTTTATTGATTTAATGACAAATAAAGGAAATTAATTAATTTTTTTTCCTGCTGTGATACTGCATTAAGCTCACATGAAAATCATGAT

GCTAGAGTTTGGAATGCAAAATTAAATGTTTCAACCTCAAGCTGGGAATATTTTTTAAAATAAATACTATAAGTATCAAATTATTACCTCCCCTACTTTA

TGTTGAAATTTTTTTTATTGAATTGATACAACTTTGTTTCCATTGTATTCATGATGTTCTGTTCTATATAACATTAAAACATTCATTAAAACCAA
Translation
MLNMWKVRELVDKA - UNI1428 - ATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAK KATFMYEQFPELMNMLWSRMLKDNKKNWRRVYK - 

UNI30178 - SLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVD - UNI30260 - DEHGKDQGINIRQKVKELVEFAQDDDRLREERKKAKKN

KDKYVGVSSDSVGGFRYN NERYDPEPKSKWDEEWDKNKSAFPFSDKLGELSDKIGSTIDDTISKFRRKDREDSPERCS SDSDEEKKARRGRSPKGEFK

DEEETVTTKHIHITQATETTTTRHKRTANPSKTIDLGAAAHYTGDKASPDQNASTHTPQSSAK - UNI9734 - PSVPSSKSSGDLVDLFDGSSQSAG

 - UNI479 - GGSADLFGGFADFGSAAASGNFPSQA - UNI6825 - ATSGNGDFGDWSAFNQAPSGPVASGGELFGSAPQSAVELISASQPALGP

PPAASNSADLFDLMGSSQATMTSSQSMNFSLMSTNTVGLGLPMSRSQ NTDMVQKSASKTLPSTWSDPSVNISLDNLLPGMQPSKPQQPSLNTMIQQQN 

NMQQPLNVMTQSFGAVNLSSPSNMLPVRPQTNPLLGGPMPMNMPGVMTGTMGMAPLGNSAGMSQGMVGMNMNMGMSASGMGLSGTMGMGMPSMAMPSGTV

QPKQDAFANFANFSK
Transcript ENSMUST00000109261
Sequence
GGCTGTGGCCGGGAGAAGGAGCTCCGGCTAGGGAGAGTTCGCGGCGGTGGGTGGCGGCGGCGACCCGGACCTGGACCAGCCCCGGCGCGGAGGCGTCCCG

GGGTCCGTGGAGAGTGGCGGCGGGCGGCGGCGGGCCGGGCCGCGCGGGGCGCGATGCTGAACATGTGGAAGGTGCGGGAGCTGGTGGACAAAGC - UNI

1428 - CACCAATGTGGTTATGAATTACTCAGAGATTGAGTCTAAGGTTCGAGAAGCAACGAATGATGATCCCTGGGGACCTTCTGGGCAGCTCATGGG

AGAGATTGCCAA GGCTACCTTTATGTATGAGCAGTTCCCAGAACTCATGAACATGCTTTGGTCCCGGATGCTAAAAGACAACAAAAAGAACTGGAGAAG

AGTTTATAAG - UNI30178 - TCGTTGCTGCTCCTAGCTTACCTCATAAGAAATGGATCGGAGCGAGTTGTTACAAGTGCCAGAGAACACATTTATG

ATTTGCGATCCCTGGAAAATTACCACTTTGTAG - UNI30260 - ATGAGCATGGCAAGGATCAAGGTATAAACATTCGACAGAAAGTAAAGGAACTG

GTTGAGTTTGCACAGGATGATGACAGGCTTCGAGAAGAGCGAAAGAAAGCAAAGAAGAACAAAGACAAGTATGTCGGGGTCTCTTCAGACAGCGTTGGTG

GATTCCGATACA ATGAGCGGTACGATCCTGAGCCCAAGTCCAAATGGGACGAAGAGTGGGATAAGAACAAGAGCGCGTTTCCGTTCAGTGACAAGCTGG

GCGAGCTGAGCGACAAGATCGGGAGCACGATCGACGACACCATCAGCAAGTTCCGGAGGAAAGACCGGGAGGACTCTCCGGAAAGGTGCAG CGACAGTG

ATGAGGAAAAGAAAGCAAGAAGAGGTAGATCTCCCAAAGGTGAATTCAAAGATGAAGAGGAAACGGTGACGACGAAGCATATCCACATCACACAGGCCAC

AGAGACCACCACAACCCGGCACAAGCGCACAGCAAACCCTTCCAAAACCATTGATCTTGGAGCAGCAGCACATTACACGGGGGACAAAGCCAGCCCAGAT

CAGAATGCTTCAACCCACACGCCTCAGTCGTCAGCCAAG - UNI9734 - CCATCGGTGCCGAGCAGCAAGTCCTCGGGGGACCTCGTTGACCTGTTT

GATGGCAGTAGCCAGTCAGCAG - UNI479 - GTGGATCAGCTGATTTATTTGGGGGATTTGCTGACTTTGGCTCAGCTGCTGCATCAGGCAATTTCC

CTTCCCAAG - UNI6825 - CAACAAGTGGGAATGGTGACTTTGGTGACTGGAGTGCCTTCAACCAAGCCCCATCAGGCCCTGTGGCTTCTGGTGGTG

AGCTCTTCGGCAGTGCCCCACAGTCGGCTGTGGAGCTTATCAGTGCTTCACAGCCAGCTTTAGGCCCACCGCCTGCTGCCTCAAACTCGGCAGACCTGTT

TGATCTTATGGGCTCATCCCAGGCAACCATGACGTCTTCCCAGAGCATGAATTTCTCTCTCATGAGCACTAACACCGTGGGACTTGGTTTGCCCATGTCC

AGATCACAG CCTCTGCAGAATGTTAGTGCAGTGCTGCAGAAGCCTAACCCTCTCTATCATCAGAATACAGATATGGTCCAGAAGTCGGCCAGCAAAACC

CTGCCCTCTACTTGGTCTGACCCCAGTGTCAACATCAGCCTAGACAACTTACTACCTGGTATGCAGCCTTCCAAGCCCCAGCAGCCATCGCTTAATACAA

TGATTCAACAACAGA ATATGCAACAGCCTCTGAATGTGATGACACAAAGCTTTGGAGCTGTGAACCTCAGTTCTCCATCAAACATGCTTCCTGTCCGGC

CTCAAACTAACCCTCTCCTGGGGGGACCCATGCCTATGAACATGCCCGGTGTAATGACGGGCACCATGGGAATGGCCCCTCTGGGGAACAGCGCAGGGAT

GAGCCAGGGCATGGTGGGCATGAACATGAACATGGGGATGTCGGCCTCGGGGATGGGCTTGTCGGGCACCATGGGAATGGGCATGCCCAGCATGGCCATG

CCTTCTGGAACTGTGCAACCCAAGCAAGATGCCTTTGCAAACTTTGCCAACTTTAGCAAATAAAAGGTTGTAACGG
Translation
MLNMWKVRELVDKA - UNI1428 - ATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAK KATFMYEQFPELMNMLWSRMLKDNKKNWRRVYK - 

UNI30178 - SLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVD - UNI30260 - DEHGKDQGINIRQKVKELVEFAQDDDRLREERKKAKKN

KDKYVGVSSDSVGGFRYN NERYDPEPKSKWDEEWDKNKSAFPFSDKLGELSDKIGSTIDDTISKFRRKDREDSPERCS SDSDEEKKARRGRSPKGEFK

DEEETVTTKHIHITQATETTTTRHKRTANPSKTIDLGAAAHYTGDKASPDQNASTHTPQSSAK - UNI9734 - PSVPSSKSSGDLVDLFDGSSQSAG

 - UNI479 - GGSADLFGGFADFGSAAASGNFPSQA - UNI6825 - ATSGNGDFGDWSAFNQAPSGPVASGGELFGSAPQSAVELISASQPALGP

PPAASNSADLFDLMGSSQATMTSSQSMNFSLMSTNTVGLGLPMSRSQ PLQNVSAVLQKPNPLYHQNTDMVQKSASKTLPSTWSDPSVNISLDNLLPGMQ

PSKPQQPSLNTMIQQQN NMQQPLNVMTQSFGAVNLSSPSNMLPVRPQTNPLLGGPMPMNMPGVMTGTMGMAPLGNSAGMSQGMVGMNMNMGMSASGMGL

SGTMGMGMPSMAMPSGTVQPKQDAFANFANFSK

For any suggestions or comments, please send an email to unitrap@crg.es