Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000006281 (Tep1)
Chromosomal location
Chr 14: 51443737 - 51490235 (-)
Description
telomerase associated protein 1 Gene [Source:MGI Symbol;Acc:MGI:109573]
RefSeq_dna
NM_009351 
RefSeq_peptide
NP_033377.1 
UniGene
Mm.318736 
MGI
MGI:109573 
Uniprot/SWISSPROT
P97499 
Uniprot/SPTREMBL
Q3UZN7 Q5XKB2 
Human Ortholog
ENSG00000129566 (TEP1)
Omim not available
UniTrap UNI26983
Vector Insertion
Chr 14: 51488261 - 51490087
Public Clones not available
Private Clones OST80282 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32015
Vector Insertion
Chr 14: 51451406 - 51453243
Public Clones IST13797H12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37153
Vector Insertion
Chr 14: 51446875 - 51448579
Public Clones CMHD-GT_488H8-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000006444
Sequence
TCACCCCTTGGCCTCACTAGGGTGTTGGTTTTCTTTCAGTTCTCTGCTTCCAACCAGTCCACTGGCTGACCCAGGCCGGTTTCTGCTCCCCGTTGCGGAG

AACCAACGCGCCTCTCATTGCGCACAGCTTTTCCAATCCTGAGCGCAG - UNI26983 - GCATATGTTGATTGTTCTTCAGCTATGGAGAAGCTCTG

TGGGCATGTGCCTGGCCATTCAGACATCCTCTCCTTGAAGAACCGGTGCCTGACCATGCTCCCTGACCTCCAGCCCCTGGAGAAAATACATGGACATAGA

TCTGTCCACTCAGACATCCTTTCCTTGGAGAACCAGTGTCTGACCATGCTCTCTGACCTCCAGCCCACGGAGAGAATAGATGGGCATATATCTGTCCACC

CAGACATCCTCTCCTTGGAGAATCGGTGCCTGACCATGCTCCCTGACCTCCAGCCTCTGGAGAAGCTATGTGGACATATGTCTAGTCATCCAGACGTCCT

TTCTTTGGAAAACCAATGTCTAGCTACTCTCCCCACTGTAAAGAGCACTGCATTGACCAGCCCCTTGCTCCAGGGTCTTCACATATCTCATACGGCACAA

GCTGATCTGCATAGCCTGAAAACTAGCAACTGCCTGCTCCCTGAGCTTCCTACCAAGAAGACTCCATGTTTCTCTGAGGAACTAGACCTTCCACCTGGAC

CCAGGGCCCTGAAATCCATGTCTGCTACAGCTCAAGTCCAGGAAGTAGCCTTG GGTCAATGGTGTGTCTCCAAAGAAAAGGAATTTCAAGAAGAAGAAA

GCACAGAAGTCCCAATGCCTTTGTACAGTCTAAGCTTGGAAGAAGAAGAAGTGGAGGCACCGGTCTTAAAACTCACATCTGGAGACTCTGGCTTTCATCC

TGAAACCACTGACCAGGTCCTTCAGGAGAAGAAG ATGGCTCTCTTGACCTTACTCTGCTCTGCTCTGGCCTCAAATGTGAATGTGAAAGATGCATCTGA

CCTTACCCGGGCATCCATCCTTGAAGTCTGTAGTGCCCTGGCCTCCTTGGAACCGGAGTTCATCCTTAAG GCATCTTTGTATGCTCGGCAGCAACTTAA

CCTCCGGGACATCGCCAATACAGTTCTGGCTGTGGCTGCCCTCTTGCCAGCCTGCCGCCCCCATGTACGACGGTATTACTCCGCCATTGTTCACCTGCCT

TCAGACTGGATCCAGGTAGCCGAGTTCTACCAG AGCCTGGCAGAAGGGGATGAGAAGAAGTTGGTGTCCCTGCCTGCCTGTCTCCGAGCTGCCATGACC

GACAAATTTGCCGAGTTTGATGAGTACCAGCTAGCTAAGTACAACCCACGGAAACATCGGTCCAAGAGGCGGTCCCGCCAGCCACCCCGCCCTCAA AAG

ACAGAACGTCCATTTTCAGAGAGAGGGAAATGTTTTCCAAAGAGCCTTTGGCCCCTTAAAAATGAACAGATTACG TTTGAAGCAGCTTATAATGCAATG

CCAGAGAAAAACAGGCTACCACGGTTCACTCTGAAGAAGTTGGTAGAGTATCTACATATCCACAAGCCTGCTCAGCACGTCCAGGCCCTGCTGGGCTACA

G GTACCCAGCCACCCTAGAGCTCTTTTCTCGGAGTCACCTCCCTGGGCCGTGGGAGTCTAGCAGAGCTGGTCAGCGGATGAAGCTCCGAAGGCCAGAGA

CCTGGGAGCGGGAGCTGAGTTTACGGGGAAACAAAGCTTCTGTGTGGGAGGAGCTCATAG ACAATGGGAAACTGCCCTTCATGGCCATGCTCCGGAACC

TGTGTAACCTGCTGCGGACTGGGATCAGTGCCCGCCACCATGAACTCGTTCTCCAGAGACTCCAGCATGAG AAATCTGTGGTTCACAGTCGGCAGTTTC

CATTCAGATTCCTTAATGCTCATGACTCTATCGATAAACTTGAGGCTCAGCTCAGAAGCAAAG CATCACCCTTCCCTTCCAATACAACATTGATGAAAC

GGATAATGATTAGAAACTCAAAAAAAAATAGGAGGCCTGCCAGTCGGAAGCACCTGTGCACCCTGACGCGCCGGCAGCTTCGGGCAGCAATGACTATACC

TGTGATGTATGAGCAGCTCAAGCGGGAGAAACTGAGGCTGCACAAGGCCAG ACAATGGAACTGTGATGTTGAGTTGCTGGAGCGCTATCGCCAGGCCCT

GGAAACAGCTGTGAACCTCTCAGTAAAGCACAACCTATCCCCGATGCCTGGCCGAACCCTCTTGGTCTATCTCACAGATGCAAATGCCGACAGGCTCTGT

CCCAAGAGTCACTCACAAGGG CCTCCCCTGAACTATGTGCTGCTGCTGATCGGAATGATGGTGGCTCGAGCCGAGCAAGTGACTGTTTGCTTGTGTGGG

GGAGGATTTGTGAAGACACCGGTACTTACAGCCGATGAAGGCATCCTGAAGACTGCCATCAAACTTCAGGCTCAAGTCCAG GAGTTAGAAGGCAATGAT

GAGTGGCCCCTGGACACTTTTGGGAAGTATCTGCTGTCTCTGGCTGTCCAAAGGACCCCC ATTGACAGGGTCATCCTGTTTGGTCAAAGGATGGATACC

GAGCTCCTGAAAGTAGCCAAACAGATTATCTGGCAGCATGTGAATTCCAAGTGCCTCTTTGTTGGTGTCCTCCTACAGAAAACACAGTACAT ATCACCA

AATTTGAATCCCAACGATGTGACGCTCTCAGGCTGCACTGACGGGATCCTGAA ATTCATTGCCGAACATGGAGCCTCTCGTCTCCTGGAACATGTGGGA

CAACTAGATAAACTATTCAAGATCCCCCCACCCCCAGGAAAGACACAGGCACCGTCTCTCCGGCCGCTGGAGGAGAACATCCCTGGTCCCTTGGGTCCTA

TTTCCCAGCATGG ATGGCGCAATATCCGGCTTTTCATTTCATCCACTTTCCGTGACATGCATGGGGAGCGAGATTTGCTGATGAGATCTGTTCTGCCCG

CACTGCAGGCCAGAGTGTTCCCCCACCGCATCAGTCTTCACGCCATTGACCTGCGCTGGGGTATCACAGAGGAAGAGACCCGCAGGAACAG ACAACTGG

AAGTGTGCCTTGGGGAGGTGGAGAACTCACAGCTGTTCGTGGGGATTCTGGGCTCCCGCTATGGCTACATTCCCCCCAGCTATGATCTTCCTGATCATCC

CCACTTTCACTGG ACCCATGAGTACCCTTCAGGGCGATCCGTGACAGAGATGGAGGTGATGCAATTCCTGAACCGTGGCCAACGCTCGCAGCCTTCGGC

CCAAGCTCTCATCTACTTCCGAGATCCTGATTTCCTTAG CTCTGTGCCAGATGCCTGGAAACCTGACTTTATATCTGAGTCAGAAGAAGCTGCACATCG

GGTCTCAGAGCTGAAGAGATATCTACACGAACAGAAAGAGGTTACCTGTCGCAG CTACTCCTGTGAATGGGGAGGTGTAGCGGCTGGCCGGCCCTATAC

TGGGGGCCTGGAGGAGTTTGGACAGTTGGTTCTCCAGGATGTGTGGAGCATGATCCAGAAGCAGCACCTGCAG CCTGGGGCCCAGTTGGAGCAGCCAAC

ATCCATCTCAGAAGACGATTTGATCCAGACCAGCTTTCAGCAGCTGAAGACCCCAACGAGTCCGGCACGGCCACGCCTTCTTCAGGATACAGTGCAGCAG

CTGTTGCTGCCCCATGGGAGGCTGAGCCTAGTGACTGGGCAGGCAGGACAGGGAAAGACTGCCTTTCTG GCATCCCTTGTGTCTGCCCTGAAGGTCCCT

GACCAGCCCAATGAGCCCCCGTTCGTTTTCTTCCACTTTGCAGCAGCCCGCCCTGACCAGTGTCTTGCTCTCAACCTCCTCAGACGCCTCTGTACCCATC

TGCGTCAAAAACTGGGAGAGCTGAGTGCCCTCCCCAGCACTTACAG AGGCCTGGTGTGGGAACTGCAGCAGAAGTTGCTCCTCAAATTCGCTCAGTCGC

TGCAGCCTGCTCAGACTTTGGTCCTTATCATCGATGGGGCAGATAAGTTGGTGGATCGTAATGGGCAGCTGATTTCAGACTGGATCCCCAAGTCTCTTCC

GCGG CGAGTACACCTGGTGCTGAGTGTGTCCAGTGACTCAGGCCTGGGTGAGACCCTTCAGCAAAGTCAGGGTGCTTATGTGGTGGCCTTGGGCTCTTT

GGTCCCATCTTCAAGGGCTCAGCTTGTGAGAGAAGAGCTAGCACTGTATGGGAAACGACTGGAGGAGTCACCTTTTAACAACCAG ATGCGGCTGCTGCT

GGCAAAGCAGGGTTCAAGCCTGCCATTGTACCTGCACCTTGTCACTGACTACCTGAGGCTCTTCACACTGTATGAACAG GTGTCTGAGAGACTTCGAAC

CCTGCCCGCCACTCTCCCACTGCTCTTGCAGCACATCCTGAGCACCTTGGAGCAAGAACATGGCCATGATGTCCTTCCTCAGGCTTTGACTGCCCTTGAG

GTCACACGAAGTG GTCTGACTGTGGACCAGCTACATGCAATCCTGAGCACATGGCTGATCTTGCCCAAGGAGACTAAGAGCTGGGAAGAAGTGCTGGCT

GCCAGTCACAGTGGAAACCCTTTCCCCTTGTGTCCATTTGCCTACCTTGTCCAGAGTCTACGCAG TTTACTAGGGGAGGGCCCAGTGGAGCGCCCTGGT

GCCCGTCTCTGCCTCTCTGATGGGCCCCTGAGGACAACAATTAAACGTCGCTATGGGAAAAGGCTGGGGCTAGAGAAGACTGCGCATGTCCTCATTGCAG

 CTCACCTCTGGAAGACGTGTGATCCTGATGCCTCGGGCACCTTCCGAAGTTGCCCTCCTGAGGCTCTGAAAGATTTACCTTACCACCTG CTCCAGAGC

GGGAACCATGGTCTCCTTGCCGAGTTTCTTACCAATCTCCATGTGGTTGCTGCATATCTGGAAGTGGGTCTAGTCCCCGACCTCTTGGAGGCTCATGTGC

TCTATG CTTCTTCAAAGCCTGAAGCCAACCAGAAGCTCCCAGCGGCAGATGTTGCTGTTTTCCATACCTTCCTGAGACAACAGGCTTCACTCCTTACCC

AGTATCCTTTGCTCCTGCTCCAGCAGGCAGCTAGCCAGCCTGAAGAGTCACCTGTTTGCTGCCAGGCCCCCCTGCTCACCCAGCGATGGCACGACCAGTT

CACACTGAAATGGATTAATAAACCCCAGACCCTGAAGGGTCAGCAAAG CTTGTCTCTGACAATGTCCTCATCCCCAACTGCTGTGGCCTTCTCCCCGAA

TGGGCAAAGAGCAGCTGTGGGGACCGCCAGTGGGACAATTTACCTGTTGAACTTGAAAACCTGGCAG GAGGAGAAGGCTGTGGTGAGTGGCTGTGACGG

GATTTCCTCTTTTGCATTCCTTTCGGACACTGCCCTTTTCCTTACTACCTTCGACGGGCACCTAGAGCTTTGGGACCTGCAACATGGTTGTTG GGTGTT

TCAGACCAAGGCCCACCAGTACCAAATCACTGGCTGCTGCCTGAGCCCAGACCGCCGCCTGCTGGCCACTGTGTGTTTGGGAGGATACCTAAAG CTGTG

GGACACAGTCCGAGGACAGCTGGCTTTTCAGTACACCCATCCAAAGTCTCTCAACTGCGTTGCCTTCCACCCAGAGGGGCAGGTGGTAGCCACAGGCAGC

TGGGCTGGCAGCATTACCTTCTTCCAGGCAGATGGACTCAAAGTCACCAAG GAACTAGGGGCCCCCGGACCCTCTGTCTGTAGTTTGGCATTCAACAAA

CCTGGGAAGATTGTGGCTGTGGGCCGGATAGATGGGACAGTGGAGCTGTGGGCCTGGCAAGAGGGTGCCCGGCTGGCGGCCTTCCCTGCACAGTGTGGCT

GTGTCTCTGCTGTTCTTTTCTTGCATGCTGGAGACCGGTTCCTGACTGCTGGAGAAGATGGCAAG GCTCAGTTATGGTCAGGATTTCTTGGCCGGCCCA

GGGGTTGCCTGGGCTCTCTTCCTCTTTCTCCTGCACTCTCGGTGGCTCTCAACCCAGACGGTGACCAGGTGGCTGTTGGGTACCGAGAAGATGGCATTAA

CATCTACAAGATTTCTTCAG GTTCCCAGGGGCCTCAGCATCAAGAGCTAAATGTGGCGGTGTCTGCACTGGTGTGGCTGAGCCCTAGTGTTTTGGTGAG

TGGTGCAGAAGATGGATCCCTGCATGGTTGGATGTTCAAGGGAGACTCCCTTCATTCCCTGTGGCTGTTGTCGAGATACCAGAAGCCTGTGCTGGGACTG

GCTGCCTCCCGGGAACTCATGGCTGCTGCCTCAG AGGACTTCACTGTGAGACTGTGGCCCAGACAGCTGCTGACACAGCCACATGTGCATGCGGTAGAG

TTGCCCTGTTGTGCTGAACTCCGGGGACACGAGGGGCCAGTGTGCTGCTGTAGCTTCAGCCCTGATGGAGGCATCTTGGCCACAGCTGGCAGGGATCGG 

- UNI32015 - AATCTCCTTTGCTGGGACATGAAGATAGCCCAAGCCCCTCTCCTGATTCACACTTTCTCGTCCTGTCATCGTGACTGGATCACTGGC

TGTGCGTGGACCAAAGACAACATCCTG - UNI32015 - GTCTCCTGCTCGAGTGATGGCTCTGTGGGACTCTGGAACCCAGAGGCAGGGCAGCAACT

TGGCCAGTTCTCAGGCCACCAGAGTGCCGTGAGCGCCGTGGTTGCTGTG - UNI32015 - GAGGAACACATTGTATCTGTGAGCCGAGATGGGACCT

TGAAAGTGTGGGACCATCAGGGTGTGGAGCTGACCAGCATCCCTGCCCATTCCGGACCCATCAGCCAGTGTGCAGCTGCTCTGGAGCCCCGCCCAG GGG

GACAGCCTGGATCAGAGCTTCTGGTGGTGACTGTTGGACTAGATGGGGCCACAAAGTTGTGGCATCCCCTGTTG GTGTGCCAAATACGTACTCTCCAGG

GACACAGTGGCCCAGTCACAGCAGCTGCTGCTTCAGAGGCCTCAGGCCTCCTGCTGACCTCAGATGATAGCTCTGTACAGCTCTGGCAGATACCAAAGGA

AGCAG ATGATTCATACAAACCTAGGAGTTCTGTGGCCATCACTGCTGTGGCATGGGCACCGGATGGTTCTATGGTGGTGTCCGGAAATGAAGCCGGGGA

ACTGACACTGTGGCAGCAAGCCAAGGCTGTGGCTACCGCACAG GCTCCAGGCCGCGTCAGTCACCTGATCTGGTACTCGGCAAATTCATTCTTCGTTCT

CAGTGCTAATGAAAACGTCAGCGAGTGGCAAGTGGGACTGAGGAAAGGTTCAACGTCCACCAGTTCCAG TCTTCATCTGAAGAGAGTTCTGCAGGAGGA

CTGGGGAGTCTTGACAGGTCTGGGTCTGGCCCCTGATGGCCAGTCTCTCATCTTGATGAAAGAGGATGTGGAATTACTAGAGATGAAGCCTGGGTCTATT

CCATCTTCTATCTG CAGGAGGTATGGAGTACATTCTTCAATACTGTGCACCAGCAAGGAGTACGGCTTGTTCTACCTGCAGCAGGGGGACTCCGGATTA

CTTTCTATATTG GAGCAAAAGGAGTCAGGGGAGTTTGAAGAGATCCTGGACTTCAATCTGAACTTAAATAATCCTAATGGGTCCCCAGTATCAATCACT

CAGGCCAAACCTGAGTCTG AATCATCCCTTTTGTGCGCCACCTCTGATGGGATGCTGTGGAACTTATCTGAATGTACCTCAGAGGGAGAATGGATCGTA

GATAACATTTGGCAGAAAAAAGCAAAAAAACCTAAAACTCAGACTCTGGAGACAGAGTTGTCCCCGCACTCAGAGTTGGATTTTTCCATTGATTGCTGGA

TTGATCCCACAAATTTAAAGGCACAGCAGTGTAAAAAG ATCCACTTGGGCTCTGTCACAGCCCTCCATGTGCTTCCGGGATTGCTGGTGACAGCTTCGA

AGGACAGAGATGTTAAGCTGTGGGAGAGACCCAGTATGCAGCTG CTGGGCTTGTTCCGATGTGAAGGGCCAGTGAGCTGTCTGGAACCTTGGATGGAGC

CCAGCTCTCCCCTGCAGCTTGCTGTGGGAGACACACAAGGAAACTTGTATTTTCTATCTTGGGAATGAAGATGCAGTACTCAGGACAAAGATGATGTCAA

CAGATGCTGCTAGCCTGAAGACACCTGTGTCTATATTCTTAGTAAGATTATAAAACTAAAATGTTGAGAGATCT
Translation
 - UNI26983 - MEKLCGHVPGHSDILSLKNRCLTMLPDLQPLEKIHGHRSVHSDILSLENQCLTMLSDLQPTERIDGHISVHPDILSLENRCLTMLP

DLQPLEKLCGHMSSHPDVLSLENQCLATLPTVKSTALTSPLLQGLHISHTAQADLHSLKTSNCLLPELPTKKTPCFSEELDLPPGPRALKSMSATAQVQE

VAL GQWCVSKEKEFQEEESTEVPMPLYSLSLEEEEVEAPVLKLTSGDSGFHPETTDQVLQEKK MALLTLLCSALASNVNVKDASDLTRASILEVCSAL

ASLEPEFILK ASLYARQQLNLRDIANTVLAVAALLPACRPHVRRYYSAIVHLPSDWIQVAEFYQ SLAEGDEKKLVSLPACLRAAMTDKFAEFDEYQLA

KYNPRKHRSKRRSRQPPRPQ KTERPFSERGKCFPKSLWPLKNEQIT FEAAYNAMPEKNRLPRFTLKKLVEYLHIHKPAQHVQALLGYR RYPATLELF

SRSHLPGPWESSRAGQRMKLRRPETWERELSLRGNKASVWEELID DNGKLPFMAMLRNLCNLLRTGISARHHELVLQRLQHE KSVVHSRQFPFRFLNA

HDSIDKLEAQLRSKA ASPFPSNTTLMKRIMIRNSKKNRRPASRKHLCTLTRRQLRAAMTIPVMYEQLKREKLRLHKAR RQWNCDVELLERYRQALETA

VNLSVKHNLSPMPGRTLLVYLTDANADRLCPKSHSQG PPLNYVLLLIGMMVARAEQVTVCLCGGGFVKTPVLTADEGILKTAIKLQAQVQ ELEGNDEW

PLDTFGKYLLSLAVQRTP IDRVILFGQRMDTELLKVAKQIIWQHVNSKCLFVGVLLQKTQYI ISPNLNPNDVTLSGCTDGILK KFIAEHGASRLLEH

VGQLDKLFKIPPPPGKTQAPSLRPLEENIPGPLGPISQHG GWRNIRLFISSTFRDMHGERDLLMRSVLPALQARVFPHRISLHAIDLRWGITEEETRRN

R RQLEVCLGEVENSQLFVGILGSRYGYIPPSYDLPDHPHFHW THEYPSGRSVTEMEVMQFLNRGQRSQPSAQALIYFRDPDFLS SSVPDAWKPDFIS

ESEEAAHRVSELKRYLHEQKEVTCRS SYSCEWGGVAAGRPYTGGLEEFGQLVLQDVWSMIQKQHLQ PGAQLEQPTSISEDDLIQTSFQQLKTPTSPAR

PRLLQDTVQQLLLPHGRLSLVTGQAGQGKTAFL ASLVSALKVPDQPNEPPFVFFHFAAARPDQCLALNLLRRLCTHLRQKLGELSALPSTYR RGLVWE

LQQKLLLKFAQSLQPAQTLVLIIDGADKLVDRNGQLISDWIPKSLPR RVHLVLSVSSDSGLGETLQQSQGAYVVALGSLVPSSRAQLVREELALYGKRL

EESPFNNQ MRLLLAKQGSSLPLYLHLVTDYLRLFTLYEQ VSERLRTLPATLPLLLQHILSTLEQEHGHDVLPQALTALEVTRSG GLTVDQLHAILST

WLILPKETKSWEEVLAASHSGNPFPLCPFAYLVQSLRS SLLGEGPVERPGARLCLSDGPLRTTIKRRYGKRLGLEKTAHVLIAA AHLWKTCDPDASGT

FRSCPPEALKDLPYHL LQSGNHGLLAEFLTNLHVVAAYLEVGLVPDLLEAHVLYA ASSKPEANQKLPAADVAVFHTFLRQQASLLTQYPLLLLQQAAS

QPEESPVCCQAPLLTQRWHDQFTLKWINKPQTLKGQQS SLSLTMSSSPTAVAFSPNGQRAAVGTASGTIYLLNLKTWQ EEKAVVSGCDGISSFAFLSD

TALFLTTFDGHLELWDLQHGCW WVFQTKAHQYQITGCCLSPDRRLLATVCLGGYLK LWDTVRGQLAFQYTHPKSLNCVAFHPEGQVVATGSWAGSITF

FQADGLKVTK ELGAPGPSVCSLAFNKPGKIVAVGRIDGTVELWAWQEGARLAAFPAQCGCVSAVLFLHAGDRFLTAGEDGK AQLWSGFLGRPRGCLGS

LPLSPALSVALNPDGDQVAVGYREDGINIYKISSG GSQGPQHQELNVAVSALVWLSPSVLVSGAEDGSLHGWMFKGDSLHSLWLLSRYQKPVLGLAASR

ELMAAASE EDFTVRLWPRQLLTQPHVHAVELPCCAELRGHEGPVCCCSFSPDGGILATAGRDR - UNI32015 - NLLCWDMKIAQAPLLIHTFSSC

HRDWITGCAWTKDNIL - UNI32015 - VSCSSDGSVGLWNPEAGQQLGQFSGHQSAVSAVVAV - UNI32015 - EEHIVSVSRDGTLKVWDHQG

VELTSIPAHSGPISQCAAALEPRPG GGQPGSELLVVTVGLDGATKLWHPLL VCQIRTLQGHSGPVTAAAASEASGLLLTSDDSSVQLWQIPKEAD DD

SYKPRSSVAITAVAWAPDGSMVVSGNEAGELTLWQQAKAVATAQ APGRVSHLIWYSANSFFVLSANENVSEWQVGLRKGSTSTSSS SLHLKRVLQEDW

GVLTGLGLAPDGQSLILMKEDVELLEMKPGSIPSSIC CRRYGVHSSILCTSKEYGLFYLQQGDSGLLSIL EQKESGEFEEILDFNLNLNNPNGSPVSI

TQAKPESE ESSLLCATSDGMLWNLSECTSEGEWIVDNIWQKKAKKPKTQTLETELSPHSELDFSIDCWIDPTNLKAQQCKK IHLGSVTALHVLPGLLV

TASKDRDVKLWERPSMQL LGLFRCEGPVSCLEPWMEPSSPLQLAVGDTQGNLYFLSWE

For any suggestions or comments, please send an email to unitrap@crg.es