Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000006304 (Arpc2)
Chromosomal location
Chr 1: 74283071 - 74314787 (+)
Description
actin related protein 2/3 complex, subunit 2 Gene [Source:MGI (curated);Acc:Arpc2-001]
RefSeq_dna
NM_029711 
RefSeq_peptide
NP_083987.1 
UniGene
Mm.337038 
MGI
MGI:1923959 
Uniprot/SWISSPROT
Q9CVB6 
Uniprot/SPTREMBL
Q3UA52 Q4FZG5 
Human Ortholog
ENSG00000163466 (ARPC2)
Omim not available
UniTrap UNI8119
Vector Insertion
Chr 1: 74283391 - 74283474
Public Clones RRG195 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25779
Vector Insertion
Chr 1: 74283391 - 74283474
Public Clones not available
Private Clones OST166583 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12126
Vector Insertion
Chr 1: 74283622 - 74292653
Public Clones (sanger) M074D04 (ggtc) IST14537H6 (tigm) IST14416D4 (tigm) IST14588A8 (tigm)
Private Clones OST383163 (lexicon) OST317730 (lexicon) OST257825 (lexicon) OST164877 (lexicon)
OST121083 (lexicon) OST120984 (lexicon) OST119121 (lexicon) OST115116 (lexicon)
OST106880 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17610
Vector Insertion
Chr 1: 74292689 - 74294705
Public Clones IST11651E8 (tigm)
Private Clones OST439693 (lexicon) OST413692 (lexicon) OST391410 (lexicon) OST356358 (lexicon)
OST251156 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35302
Vector Insertion
Chr 1: 74294819 - 74297827
Public Clones IST10833F7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6184
Vector Insertion
Chr 1: 74297874 - 74301401
Public Clones CSG174 (baygenomics)
Private Clones OST379747 (lexicon) OST200766 (lexicon) OST186042 (lexicon) OST7122 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19383
Vector Insertion
Chr 1: 74302626 - 74309032
Public Clones (sanger) 3SE306A08 (ggtc) CMHD-GT_297G4-3 (cmhd)
Private Clones OST392645 (lexicon) OST367101 (lexicon) OST363695 (lexicon) OST349235 (lexicon)
OST328884 (lexicon) OST328877 (lexicon) OST328872 (lexicon) OST328868 (lexicon)
OST87573 (lexicon) OST29528 (lexicon) OST27281 (lexicon) OST23433 (lexicon)
OST18940 (lexicon) OST7334 (lexicon)
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28501
Vector Insertion
Chr 1: 74309160 - 74310316
Public Clones not available
Private Clones OST29467 (lexicon)
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12601
Vector Insertion
Chr 1: 74311028 - 74314344
Public Clones W188D06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113819
Sequence
AAGTAAGGCGGCGGCGGAGGCGGCGGCGGCTCGGCAGGCGGGTTGAAGCTTCGGGGGCCAG - UNI8119 - - UNI25779 - CCGCCGCCATGAT

CCTGCTGGAGGTGAACAACCGCATCATCGAGGAGACGCTCGCGCTCAAGTTCGAGAACGCGGCCGCCGGGTAAGCGCACGCCGGGAGGAGGCCGAGTTGA

CCCCAGCTAAATCCCGGGTGGCGTCCAGCTCCCCAGCCCTAGAGGGGGACAAATCGGGAACCTGGCGCGGCTTCAGGGTTTCCCTGGCAGGATGGACGTG

GGAAGCCACGGGGCGCG - UNI12126 - AAACAAACCAGAAGCTGTAGAAGTAACATTTGCAG - UNI17610 - ATTTTGATGGCGTCCTTTAT

CATATTTCAAATCCTAATGGAGACAAAACAAAAGTGATGGTCAGTATTTCTTTGAAATTCTACAAGGAACTTCAGGCACATGGAGCTGATGAG TTGTTA

AAGAGAGTGTATGGGAGCTTCTTGGTAAATCCAGAACCAG - UNI6184 - GATATAATGTTTCTTTGCTATATGACCTGGAAAATCTACCTGCATCC

AAGGATTCTATTGTGCATCAGGCTGGCATGTTGAAGCGAAATTGTTTTGCCTCTGTGTTTGAGAAATACTTCCAATTCCAAGAAGAGGGCAAAGAAGGAG

AGAACAGAGCAGTTATCCATTATAGGGATGATGAGACCAT GTATGTGGAATCTAAGAAAGACAGAGTCACAGTAGTCTTCAGCACGGTTTTTAAAGATG

ACGACGATGTGGTCATCGGAAAGGTGTTCATGCAG - UNI19383 - GAGTTCAAAGAAGGACGAAGAGCCAGCCACACAGCCCCCCAGGTCCTTTTC

AGCCACAGGGAACCTCCTCTAGAGCTGAAAGACACAGATGCTGCTGTGGGTGACAACATTGGCTACATCACCTTTG - UNI28501 - TGCTGTTCCC

TCGCCACACCAATGCCACTGCTCGAGACAACACCATCAACCTGATCCACACGTTCCGGGACTATCTGCACTACCACATTAAGTGCTCTAAG GCCTATAT

TCATACACGAATGCGAGCAAAAACATCCGACTTCCTTAAGGTGCTCAACCGTGCACGCCCAGATGCCGAGAAAAAAGAAATGAAAACAATCAC - UNI1

2601 - GGGGAAGACTTTTTCATCCCGCTAACTCTTGGGAACTGAGGAGGAAGCGCTGTCGACCGAAGGCTGGACTGCTTGCTACTGGATAATCGTAGC

CCTTCATGTTGCACCTTCTCCAGGTTCTTGAGGGATTCTCCATTTGGGTTCCATTTTGTACGAGTTTGGCAAATAACCTGCAGAAACGAGCTGTGCTTGC

AAGGACTTGATAGTTCCTAAGAATT
Translation
 - UNI8119 - - UNI25779 - MDVGSHGAR - UNI12126 - RNKPEAVEVTFAD - UNI17610 - DFDGVLYHISNPNGDKTKVMVSIS

LKFYKELQAHGADE LLKRVYGSFLVNPEPG - UNI6184 - GYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIH

YRDDETM MYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQ - UNI19383 - EFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFV - 

UNI28501 - VLFPRHTNATARDNTINLIHTFRDYLHYHIKCSK AYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTIT - UNI12601 - TGKTFS

SR
Transcript ENSMUST00000113820
Sequence
GAGAGCGGAAGTGGCCGGCTGGAGCCGGGGGCTGGGCGGGGACCGGGATCGTCAAGTAAGGCGGCGGCGGAGGCGGCGGCGGCTCGGCAGGCGGGTTGAA

GCTTCGGGGGCCAG - UNI8119 - - UNI25779 - CCGCCGCCATGATCCTGCTGGAGGTGAACAACCGCATCATCGAGGAGACGCTCGCGCTCA

AGTTCGAGAACGCGGCCGCCGG - UNI8119 - - UNI12126 - - UNI25779 - AAACAAACCAGAAGCTGTAGAAGTAACATTTGCAG - U

NI17610 - ATTTTGATGGCGTCCTTTATCATATTTCAAATCCTAATGGAGACAAAACAAAAGTGATGGTCAGTATTTCTTTGAAATTCTACAAGGAAC

TTCAGGCACATGGAGCTGATGAG TTGTTAAAGAGAGTGTATGGGAGCTTCTTGGTAAATCCAGAACCAG - UNI6184 - GATATAATGTTTCTTTG

CTATATGACCTGGAAAATCTACCTGCATCCAAGGATTCTATTGTGCATCAGGCTGGCATGTTGAAGCGAAATTGTTTTGCCTCTGTGTTTGAGAAATACT

TCCAATTCCAAGAAGAGGGCAAAGAAGGAGAGAACAGAGCAGTTATCCATTATAGGGATGATGAGACCAT GTATGTGGAATCTAAGAAAGACAGAGTCA

CAGTAGTCTTCAGCACGGTTTTTAAAGATGACGACGATGTGGTCATCGGAAAGGTGTTCATGCAG - UNI19383 - GAGTTCAAAGAAGGACGAAGA

GCCAGCCACACAGCCCCCCAGGTCCTTTTCAGCCACAGGGAACCTCCTCTAGAGCTGAAAGACACAGATGCTGCTGTGGGTGACAACATTGGCTACATCA

CCTTTG - UNI28501 - TGCTGTTCCCTCGCCACACCAATGCCACTGCTCGAGACAACACCATCAACCTGATCCACACGTTCCGGGACTATCTGCAC

TACCACATTAAGTGCTCTAAG GCCTATATTCATACACGAATGCGAGCAAAAACATCCGACTTCCTTAAGGTGCTCAACCGTGCACGCCCAGATGCCGAG

AAAAAAGAAATGAAAACAATCAC - UNI12601 - GGGGAAGACTTTTTCATCCCGCTAACTCTTGGGAACTGAGGAGGAAGCGCTGTCGACCGAAGG

CTGGACTGCTTGCTACTGGATAATCGTAGCCCTTCATGTTGCACCTTCTCCAGGTTCTTGAGGGATTCTCCATTTGGGTTCCATTTTGTACGAGTTTGGC

AAATAACCTGCAGAAACGAGCTGTGCTTGCAAGGACTTGATAGTTCCTAAGAATTAAAAAAAAAAAAAAAATTCCACTTGATCAACTTAATTCCCTTTTA

TTTTTCCTCCCTCACTCCCCTTCCTTTTCCAAGCTGTTTGCTTTGCAATATGTTACTGGTAATGAGTTGCAGGTAATGCAATCTTAACTTGTTTTCTTCT

AAGTATTTGAGTTCAAAACTCCTGTATCTAAAGAAATACGGTTGGGGTCATTAATAAAGAAAATCTTTCTATCTTA
Translation
 - UNI8119 - - UNI25779 - MILLEVNNRIIEETLALKFENAAAG - UNI8119 - - UNI12126 - - UNI25779 - GNKPEAVEVT

FAD - UNI17610 - DFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADE LLKRVYGSFLVNPEPG - UNI6184 - GYNVSLLYDLENLPA

SKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETM MYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQ - UNI19383 - EFKEG

RRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFV - UNI28501 - VLFPRHTNATARDNTINLIHTFRDYLHYHIKCSK AYIHTRMRAKTSD

FLKVLNRARPDAEKKEMKTIT - UNI12601 - TGKTFSSR
Transcript ENSMUST00000006467
Sequence
AAGTAAGGCGGCGGCGGAGGCGGCGGCGGCTCGGCAGGCGGGTTGAAGCTTCGGGGGCCAGGTCGGTCGGGTGGTGGCTGCCTGCTACAGGCAGCGCGTG

CCGGGCCAGCGCGTGTGTCCGCCTCTCCCCACCCCGCTCCCCGTCCCCTTCTCCCCTCACCTACCGCACCCAGCCCCCCTCGTCAGGGGCAGCGGGGCCG

CTCCCTCCGTCCTACCCTCGATTGCCCACCCTCACCGCCCTTGTTTCTCCTTCCCCTGCCCGGGGCAGCCGCCGCCATGATCCTGCTGGAGGTGAACAAC

CGCATCATCGAGGAGACGCTCGCGCTCAAGTTCGAGAACGCGGCCGCCGG - UNI8119 - - UNI12126 - - UNI25779 - AAACAAACCAG

AAGCTGTAGAAGTAACATTTGCAG - UNI17610 - ATTTTGATGGCGTCCTTTATCATATTTCAAATCCTAATGGAGACAAAACAAAAGTGATGGTC

AGTATTTCTTTGAAATTCTACAAGGAACTTCAGGCACATGGAGCTGATGAG TTGTTAAAGAGAGTGTATGGGAGCTTCTTGGTAAATCCAGAACCAG -

 UNI6184 - GATATAATGTTTCTTTGCTATATGACCTGGAAAATCTACCTGCATCCAAGGATTCTATTGTGCATCAGGCTGGCATGTTGAAGCGAAAT

TGTTTTGCCTCTGTGTTTGAGAAATACTTCCAATTCCAAGAAGAGGGCAAAGAAGGAGAGAACAGAGCAGTTATCCATTATAGGGATGATGAGACCAT G

TATGTGGAATCTAAGAAAGACAGAGTCACAGTAGTCTTCAGCACGGTTTTTAAAGATGACGACGATGTGGTCATCGGAAAGGTGTTCATGCAG - UNI1

9383 - GAGTTCAAAGAAGGACGAAGAGCCAGCCACACAGCCCCCCAGGTCCTTTTCAGCCACAGGGAACCTCCTCTAGAGCTGAAAGACACAGATGCT

GCTGTGGGTGACAACATTGGCTACATCACCTTTG - UNI28501 - TGCTGTTCCCTCGCCACACCAATGCCACTGCTCGAGACAACACCATCAACCT

GATCCACACGTTCCGGGACTATCTGCACTACCACATTAAGTGCTCTAAG GCCTATATTCATACACGAATGCGAGCAAAAACATCCGACTTCCTTAAGGT

GCTCAACCGTGCACGCCCAGATGCCGAGAAAAAAGAAATGAAAACAATCAC - UNI12601 - GGGGAAGACTTTTTCATCCCGCTAACTCTTGGGAA

CTGAGGAGGAAGCGCTGTCGACCGAAGGCTGGACTGCTTGCTACTGGATAATCGTAGCCCTTCATGTTGCACCTTCTCCAGGTTCTTGAGGGATTCTCCA

TTTGGGTTCCATTTTGTACGAGTTTGGCAAATAACCTGCAGAAACGAGCTGTGCTTGCAAGGACTTGATAGTTCCTAAGAATTAAAAAAAAAAAAAAAAT

TCCACTTGATCAACTTAATTCCCTTTTATTTTTCCTCCCTCACTCCCCTTCCTTTTCCAAGCTGTTTGCTTTGCAATATGTTACTGGTAATGAGTTGCAG

GTAATGCAATCTTAACTTGTTTTCTTCTAAGTATTTGAGTTCAAAACTCCTGTATCTAAAGAAATACGGTTGGGGTCATTAATAAAGAAAATCTTTCTAT

CTTACTTG
Translation
MILLEVNNRIIEETLALKFENAAAG - UNI8119 - - UNI12126 - - UNI25779 - GNKPEAVEVTFAD - UNI17610 - DFDGVLYHI

SNPNGDKTKVMVSISLKFYKELQAHGADE LLKRVYGSFLVNPEPG - UNI6184 - GYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQ

FQEEGKEGENRAVIHYRDDETM MYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQ - UNI19383 - EFKEGRRASHTAPQVLFSHREPPLELKDTDA

AVGDNIGYITFV - UNI28501 - VLFPRHTNATARDNTINLIHTFRDYLHYHIKCSK AYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTIT - UN

I12601 - TGKTFSSR

For any suggestions or comments, please send an email to unitrap@crg.es