Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000006333 (Rps9)
Chromosomal location
Chr 7: 3655640 - 3658499 (+)
Description
ribosomal protein S9 Gene [Source:MGI (curated);Acc:Rps9-001]
RefSeq_dna
NM_029767 
RefSeq_peptide
NP_084043.1 
UniGene
Mm.13944 Mm.467445 Mm.467522 Mm.467523 Mm.467524 Mm.467561 Mm.467835 
MGI
MGI:1924096 
Uniprot/SWISSPROT
Q6ZWN5 
Uniprot/SPTREMBL
Q96EC0 Q9CXW7 
Human Ortholog
ENSG00000170889 (RPS9)
Omim not available
UniTrap UNI11175
Vector Insertion
Chr 7: 3655653 - 3656051
Public Clones P012G10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14754
Vector Insertion
Chr 7: 3655667 - 3655928
Public Clones PST14469-NR (escells) PST11063-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33737
Vector Insertion
Chr 7: 3655667 - 3655928
Public Clones (ggtc) PST21759-NR (escells) IST10162F9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33039
Vector Insertion
Chr 7: 3656051 - 3656247
Public Clones IST14415F4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15659
Vector Insertion
Chr 7: 3656371 - 3657334
Public Clones PST6177-NL (escells) IST14527E12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23611
Vector Insertion
Chr 7: 3658252 - 3658460
Public Clones CMHD-GT_471F5-3 (cmhd) CMHD-GT_450G7-3 (cmhd)
Private Clones OST251725 (lexicon)
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108623
Sequence
CTCTTTGTCTCGGGCCTGAGTTCGTAG - UNI11175 - - UNI14754 - - UNI33737 - GCGCAGCCGGCCTAGCGAGGTCAACATGCCGGT

CGCCAGAAGCTGGGTTTGTCGCAAAACCTATGTGACCCCACGGAGACCCTTCGAGAAGTCGCGTCTCGACCAGGAGCTAAAGTTGATTG - UNI11175

 - - UNI33039 - GAGAGTATGGACTCCGGAACAAACGTGAGGTTTGGAGGGTCAAGTTTACCCTGGCCAAGATCCGTAAGGCGGCCCGGGAGCTGT

TGACGCTAGACGAGAAGGATCCCCGGCGTCTGTTTGAAG - UNI15659 - GCAATGCTCTCCTGCGGCGGCTTGTTCGCATTGGGGTGCTGGACGAG

GGCAAGATGAAGCTGGATTACATCCTGGGCCTGAAGATTGAGGATTTCTTGGAGAGGCGGCTGCAGACCCAGGTCTTTAAGCTGGGCCTGGCCAAATCTA

TTCACCATGCCCGTGTGCTCATCCGCCAACGTCACATTAG CCTTTGGAGCTGACAGATGTGAGCTTACCCTTGAGGGTTCAGAATCGTGCCCTGCAAAC

AGCTTATGGGGGACTGGGGACAGCCTTGTTTCCCCATAGCCCAGCGCAAGGGTCACTGCGGCTCAAGCCGTACACCTTGTGAAGGTGTCTGCCAGGCACT

CAAGCAGCTGGACAGGTAACAGCTCTTGGTGCCACCCCCCCTGGAGGGAGATTGGAGTCAATGTTGAGGTGACAAAGCTGTCTGTGGAGGTACAATCTAG

GCCTTCATTGCTATATTTCTACTTGTTAATTTGCCAGTTGAGAATGCACCTGTCTGAAGTGACTGGGGTAAATGAAATTGCATGCTCGTTAACCCTTCTG

TAAATGAGCACCAATCATGACAGCTATACAGAGTGAAGTCTCAGATTTCTTTCTCACCAGCTTTCGTTTATGGGCAGAGATGTACTCTTGTCTGAGGTGG

TTTGAGACCACATGGCATTACAATGTGGACAGGAAGCAAATCAAAGCATTAGTATGGGCACTCTTGTTTTCCTTCCAAGTTACTGAGTCTGAGGTCAGGA

GTGCCTGTGAGCCTGCTTGAGTCAAAGGGCAGGACCAAATGGTTCAGCCTCACTTTGTCCCCTTATTCTGTTCTTCCTGTCCAGGGTCCGCAAGCAGGTG

GTGAACATCCCATCCTTCATTGTTCGCCTGGACTCTCAGAAGCACATCGACTTCTCCCTCCGTTCTCCTTATGGCGGCGGCCGTCCAGGCCGAGTGAAGA

GGAAGAATGCCAAGAAAGGCCAGGGCGGGGCTGGAGCTGGTGATGATGAGGAAGAGGATTAATTAATACTTGGCTGAACTGGAGGATTGTCTAGTTTTCC

AGCTGAAAAATAAAAAAGAATTGATACTT
Translation
 - UNI11175 - - UNI14754 - - UNI33737 - MPVARSWVCRKTYVTPRRPFEKSRLDQELKLIG - UNI11175 - - UNI33039 - 

GEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLFEG - UNI15659 - GNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKL

GLAKSIHHARVLIRQRHIS SLWS
Transcript ENSMUST00000108624
Sequence
TGCGCAGGCGCAGCCGGCCTAGCGAGGTCAACATGCCGGTCGCCAGAAGCTGGGTTTGTCGCAAAACCTATGTGACCCCACGGAGACCCTTCGAGAAGTC

GCGTCTCGACCAGGAGCTAAAGTTGATTG - UNI11175 - - UNI33039 - GAGAGTATGGACTCCGGAACAAACGTGAGGTTTGGAGGGTCAAG

TTTACCCTGGCCAAGATCCGTAAGGCGGCCCGGGAGCTGTTGACGCTAGACGAGAAGGATCCCCGGCGTCTGTTTGAAG - UNI15659 - - UNI23

611 - GGTCCGCAAGCAGGTGGTGAACATCCCATCCTTCATTGTTCGCCTGGACTCTCAGAAGCACATCGACTTCTCCCTCCGTTCTCCTTATGGCGGC

GGCCGTCCAGGCCGAGTGAAGAGGAAGAATGCCAAGAAAGGCCAGGGCGGGGCTGGAGCTGGTGATGATGAGGAAGAGGATTAATTAATACTTGGCTGAA

CTGGAGGATTGTCTAGTTTTCCAGCTGAAAAA
Translation
MPVARSWVCRKTYVTPRRPFEKSRLDQELKLIG - UNI11175 - - UNI33039 - GEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLF

EG - UNI15659 - - UNI23611 - GSASRW
Transcript ENSMUST00000108625
Sequence
CCTGAGTTCGTAGGTGAGTGTTCTGATTGTTGAGTTCGCCTTTTAGGGGTTGATGGTGTAAGGTAACGGAGCCATTCGAATCTTCATGAACATGCTGAGT

AAGAGGGTGGGGCGAAGGTGGCTGGAAGTTACAACACGGTTGTGGAACAATCCCATTTTCAAGTTTTCTAAGGCGGATTTCTCTGAGAGCCGAGTTGGTG

TCGCCGTGTCCCTAGCGGGGTTTTGCTGCACATGCGCCACAAGATTATTTTTTAAAACGACACTTTACTGCGCAGGCGCAGCCGGCCTAGCGAGGTCAAC

ATGCCGGTCGCCAGAAGCTGGGTTTGTCGCAAAACCTATGTGACCCCACGGAGACCCTTCGAGAAGTCGCGTCTCGACCAGGAGCTAAAGTTGATTG - 

UNI11175 - - UNI33039 - GAGAGTATGGACTCCGGAACAAACGTGAGGTTTGGAGGGTCAAGTTTACCCTGGCCAAGATCCGTAAGGCGGCCCG

GGAGCTGTTGACGCTAGACGAGAAGGATCCCCGGCGTCTGTTTGAAG - UNI15659 - GCAATGCTCTCCTGCGGCGGCTTGTTCGCATTGGGGTGC

TGGACGAGGGCAAGATGAAGCTGGATTACATCCTGGGCCTGAAGATTGAGGATTTCTTGGAGAGGCGGCTGCAGACCCAGGTCTTTAAGCTGGGCCTGGC

CAAATCTATTCACCATGCCCGTGTGCTCATCCGCCAACGTCACATTAG - UNI23611 - GGTCCGCAAGCAGGTGGTGAACATCCCATCCTTCATTG

TTCGCCTGGACTCTCAGAAGCACATCGACTTCTCCCTCCGTTCTCCTTATGGCGGCGGCCGTCCAGGCCGAGTGAAGAGGAAGAATGCCAAGAAAGGCCA

GGGCGGGGCTGGAGCTGGTGATGATGAGGAAGAGGATTAATTAATACTTGGCTGAACTGGAGGATTGTC
Translation
MPVARSWVCRKTYVTPRRPFEKSRLDQELKLIG - UNI11175 - - UNI33039 - GEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLF

EG - UNI15659 - GNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIR - UNI23611 - RVRKQVV

NIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKNAKKGQGGAGAGDDEEED
Transcript ENSMUST00000006496
Sequence
CTCTTTGTCTCGGGCCTGAGTTCGTAG - UNI11175 - - UNI14754 - - UNI33737 - GCGCAGCCGGCCTAGCGAGGTCAACATGCCGGT

CGCCAGAAGCTGGGTTTGTCGCAAAACCTATGTGACCCCACGGAGACCCTTCGAGAAGTCGCGTCTCGACCAGGAGCTAAAGTTGATTG - UNI11175

 - - UNI33039 - GAGAGTATGGACTCCGGAACAAACGTGAGGTTTGGAGGGTCAAGTTTACCCTGGCCAAGATCCGTAAGGCGGCCCGGGAGCTGT

TGACGCTAGACGAGAAGGATCCCCGGCGTCTGTTTGAAG - UNI15659 - GCAATGCTCTCCTGCGGCGGCTTGTTCGCATTGGGGTGCTGGACGAG

GGCAAGATGAAGCTGGATTACATCCTGGGCCTGAAGATTGAGGATTTCTTGGAGAGGCGGCTGCAGACCCAGGTCTTTAAGCTGGGCCTGGCCAAATCTA

TTCACCATGCCCGTGTGCTCATCCGCCAACGTCACATTAG - UNI23611 - GGTCCGCAAGCAGGTGGTGAACATCCCATCCTTCATTGTTCGCCTG

GACTCTCAGAAGCACATCGACTTCTCCCTCCGTTCTCCTTATGGCGGCGGCCGTCCAGGCCGAGTGAAGAGGAAGAATGCCAAGAAAGGCCAGGGCGGGG

CTGGAGCTGGTGATGATGAGGAAGAGGATTAATTAATACTTGGCTGAACTGGAGGATTGTCTAGTTTTCCAGCTGAAAAATAAAAAAGAATTGATACTTG

G
Translation
 - UNI11175 - - UNI14754 - - UNI33737 - MPVARSWVCRKTYVTPRRPFEKSRLDQELKLIG - UNI11175 - - UNI33039 - 

GEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLFEG - UNI15659 - GNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKL

GLAKSIHHARVLIRQRHIR - UNI23611 - RVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKNAKKGQGGAGAGDDEEED

For any suggestions or comments, please send an email to unitrap@crg.es