Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000006362 (Cbfa2t3)
Chromosomal location
Chr 8: 125153838 - 125222793 (-)
Description
core-binding factor, runt domain, alpha subunit 2, translocated to, 3 (human) Gene [Source:MGI Symbol;Acc:MGI:1338013]
RefSeq_dna
NM_009824 
RefSeq_peptide
NP_033954.2 NP_001103343.1 NP_796263.1 
UniGene
Mm.394973 Mm.194339 
MGI
MGI:1338013 
Uniprot/SWISSPROT
O54972 
Human Ortholog
ENSG00000129993 (CBFA2T3)
Omim not available
UniTrap UNI31869
Vector Insertion
Chr 8: 125158848 - 125159731
Public Clones IST11059D7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000006525
Sequence
ATGTCCCAGGCATCCACCACCACTCTGGAGAGTGGGGCACTCCTCTCGGGACCCCGGGGTCTTCAGAATGGAAGCCCAG CTCACAGGAAGGAGAAGGCT

GCAGCAATGCCAGACTCCCCGGCTGAAGTGAAGACGCAGCCCCGGTCCACACCCCCCAGCATGCCGCCCCCACCTCCCACCTCATCCCAGGGAGCCACAC

GACCACCCTCCTTCACACCTCACACAC ATGGCGAGGATGGACCTGCGACGTCTCTTCCCCATGGCCGTTTCCACGGCTGCTTAAAGTGGTCCATGGTCT

GTCTCT TGATGAACGGCAGCAGCCACTCACCCACGGCCATCCACGGTGCCCCATCTACACCCAATGGCTTCAGCAACGGCCCAGCCACCTCATCCACGG

CCTCGCTCTCCACACAGCACCTGCCCCCGGCGTGCGGGGCACGGCAGCTCAGCAAGCTTAAGCGTTTCCTCACCACCCTACAGCAGTTTGGCAGTGACAT

CTCACCTGAGATCGGGGAGCGCGTGCGCACACTGGTGCTGGGCCTGGTG AACTCAACTCTGACGATCGAAGAGTTTCATGCCAAGCTCCAGGAAGCCAC

CAACTTTCCACTGAGGCCGTTTGTTATCCCTTTTCTGAAG GCTAATCTTCCACTGCTGCAGCGTGAGCTCCTGCACTGTGCCCGCCTGGCCAAACAGAC

ACCTGCCCAGTACCTGGCCCAGCACGAACAGCTGCTGCTGGACGCCAGCGCCACCTCCCCTGTCGACTCGTCTGAGCTCCTGCTGGAAGTCAACGAGAAC

GGCAAAAGGAGAACACCTGACAG GACCAAAGAGAATGGATCAGACCGGGACCCTCTGCACCCCGACCACCTCAGTAAGCGGTCCTGCACCCTGAGCCCC

GCCCAGCGCTGCAGCCCCAGCAATGGGCTGCCCCACCCGACGCCACCCCCACCCCCGCACTATCGCCTGGAGGACATGGCCATGGCCCACCATTTCCGGG

ACTCCTACCGCCATCCTGATCCCCGAGAGCTACGGGAACGCCACCGGCCCCTGG CCATACCTGGGTCTCGACAAGAAGAAGTGATTGATCACAGGCTCA

CAGAACGCGAGTGGGCAGAAGAATGGAAGCACCTCAACAGT - UNI31869 - CTTCTGAACTGCATCATGGACATGGTGGAGAAGACCCGGCGATCC

CTCACCGTCCTGCGCCGGTGTCAGGAGGCCGACCGTGAGGAACTCAACCACTGGATCCGGTGCTACAGTGACTCTGAGGAGGGGAAGAAGGGCCCTACCC

CCATCTCTGCCCGGTCCCTCAACAGCTGCAGTGGCCCTGAGGGGTCTCAGCTAG - UNI31869 - ATGTTCACCGGGACTTCACGCCCAGGACCCTG

TCTGGCTACATGCCTGAAGAGATCTGGAGGAAGGCTG AAGAAGCTGTGAATGAGGTGAAGCGCCAGGCCATGTCAGAACTACAGAAAGCTGTGTCTGAT

GCGGAGCGCAAAGCCCATGAACTCATCACCACAGAGCGTGCCAAGATGGAACGAGCCCTGGCGGAGGCCAAGCGACAGGCCTCGGAGGATGCCCTGACTG

TCATCAACCAGCAAGAGGACTCCAGCGAG AGCTGCTGGAACTGCGGGCGCAAGGCCAGCGAGACGTGCAGTGGCTGTAACGCCGCCCGCTACTGCGGGT

CCTTCTGTCAGCACAAAGACTGGGAGAAACACCATCACGTGTGCGGCCAGAGTCTGCAGGGCCCCGCGGCTGCAGTGGCTGACCCACTACCTGGACAGCC

TGACGCCACTGCCAGCCCCAGCGAAGCCGGCTCGGCAGGGCCCTCTCGTCCCTGCTCTCCGGGGCCGCCAGGCCCGCTGGACGCTGCTGTGCCCCGCTGA

CCTCCAGATCTGACACCCAGCCCATGGACGCCATGCCCTGCCAACCTCCTGGCCCCACCGTGGCCCACCAGTTGCCTGGAGCCATTGCTGCTACTGCTTC

TCTCCAAAAGAAAACACAGATCCAACAGAACTGCATCCGTGCAGCCCCAGCTACCTGACAAGGTCTGCCGGGACCTCTACAGCCTCTCGTCCATCGCAAG

CACCCTCAGAAAGCATCGCAGAGCGTCAGACAGTGGCACCAGCAGGAGTGTGGCCAGCTCCGCCGCTGTCTGTCCCCTCTGTGTCCGTCTCTCTGTGTCC

GTCTGTCTTTCTGCGTCTGCCTCTCTCTGTGTGTCTCTCCGTGTCTTTGTCTCCTGCCGTTTCCCTGACTCTCCGGCGTCTCTGTCTTTGTAAAGTCCAC

ATGATCTCTCTGTCATCAGAGAAACCTAGTTGGTAGCTTTTCTTTTCCATGAAGAACTTTTGGAGATTTTGTTTTGTTTTGTTGGCAAACAAGCTACTTA

GAAATGGACAAAGAAGACTGTGGGGTTCTCCCCATTCCTCATGAGTAAGGGAAGAAACTGTGATTTTTCTATCCAGAGTTGCTGTATCGCCCAGCCAGCC

CCAGGGGCATCAGCGAGCACACAGCAGAGATAATGAGAGCAACTGCAATTTCCAACTTAAGAAGCAGCTTTTGTTTCAGGTTTTACTCCTTTAATGTCAA

ACTCTTTGGCTTTAAGTGAAAAAAAAAAAAAGGAAAAAAAAATCCAAAAAGTTTTTTTTTTTTTTAAGC
Translation
MSQASTTTLESGALLSGPRGLQNGSPA AHRKEKAAAMPDSPAEVKTQPRSTPPSMPPPPPTSSQGATRPPSFTPHTH HGEDGPATSLPHGRFHGCLKW

SMVCLL LMNGSSHSPTAIHGAPSTPNGFSNGPATSSTASLSTQHLPPACGARQLSKLKRFLTTLQQFGSDISPEIGERVRTLVLGLV NSTLTIEEFHA

KLQEATNFPLRPFVIPFLK ANLPLLQRELLHCARLAKQTPAQYLAQHEQLLLDASATSPVDSSELLLEVNENGKRRTPDR RTKENGSDRDPLHPDHLS

KRSCTLSPAQRCSPSNGLPHPTPPPPPHYRLEDMAMAHHFRDSYRHPDPRELRERHRPLA AIPGSRQEEVIDHRLTEREWAEEWKHLNS - UNI3186

9 - LLNCIMDMVEKTRRSLTVLRRCQEADREELNHWIRCYSDSEEGKKGPTPISARSLNSCSGPEGSQLD - UNI31869 - DVHRDFTPRTLSGYM

PEEIWRKAE EEAVNEVKRQAMSELQKAVSDAERKAHELITTERAKMERALAEAKRQASEDALTVINQQEDSSE SCWNCGRKASETCSGCNAARYCGSF

CQHKDWEKHHHVCGQSLQGPAAAVADPLPGQPDATASPSEAGSAGPSRPCSPGPPGPLDAAVPR
Transcript ENSMUST00000064674
Sequence
GACTCGGTGAGACGCGCGGGCGAGCGCGCGGCAGCAGAGCCGAAAGCACGGCGGCTGGACCCGGCGGCCGCCGAGGCCGAAACCACCCGGGCAGCGTGCG

GGCTTTGTTCCCGCGCTGGGGGCCGAACGCACTCGGCATGGCCCAGGCGGTCGCCCCGCGCGCCCCGACCCCGCCGCGCGCCTGAGCCCCGCGCAGCGCG

AGAAGACAGCGTACGGATCGCCCCCAAGTTATGGAGGTGGCGACCCAGTGAGAAGGAAAAGCCACTTCGGGAGCCGGGTTGCGAGAGAGCTACGGTCCCC

TGGAGCTCCAGACC CTCACAGGAAGGAGAAGGCTGCAGCAATGCCAGACTCCCCGGCTGAAGTGAAGACGCAGCCCCGGTCCACACCCCCCAGCATGCC

GCCCCCACCTCCCACCTCATCCCAGGGAGCCACACGACCACCCTCCTTCACACCTCACACAC ATGGCGAGGATGGACCTGCGACGTCTCTTCCCCATGG

CCGTTTCCACGGCTGCTTAAAGTGGTCCATGGTCTGTCTCT TGATGAACGGCAGCAGCCACTCACCCACGGCCATCCACGGTGCCCCATCTACACCCAA

TGGCTTCAGCAACGGCCCAGCCACCTCATCCACGGCCTCGCTCTCCACACAGCACCTGCCCCCGGCGTGCGGGGCACGGCAGCTCAGCAAGCTTAAGCGT

TTCCTCACCACCCTACAGCAGTTTGGCAGTGACATCTCACCTGAGATCGGGGAGCGCGTGCGCACACTGGTGCTGGGCCTGGTG AACTCAACTCTGACG

ATCGAAGAGTTTCATGCCAAGCTCCAGGAAGCCACCAACTTTCCACTGAGGCCGTTTGTTATCCCTTTTCTGAAG GCTAATCTTCCACTGCTGCAGCGT

GAGCTCCTGCACTGTGCCCGCCTGGCCAAACAGACACCTGCCCAGTACCTGGCCCAGCACGAACAGCTGCTGCTGGACGCCAGCGCCACCTCCCCTGTCG

ACTCGTCTGAGCTCCTGCTGGAAGTCAACGAGAACGGCAAAAGGAGAACACCTGACAG GACCAAAGAGAATGGATCAGACCGGGACCCTCTGCACCCCG

ACCACCTCAGTAAGCGGTCCTGCACCCTGAGCCCCGCCCAGCGCTGCAGCCCCAGCAATGGGCTGCCCCACCCGACGCCACCCCCACCCCCGCACTATCG

CCTGGAGGACATGGCCATGGCCCACCATTTCCGGGACTCCTACCGCCATCCTGATCCCCGAGAGCTACGGGAACGCCACCGGCCCCTGG CCATACCTGG

GTCTCGACAAGAAGAAGTGATTGATCACAGGCTCACAGAACGCGAGTGGGCAGAAGAATGGAAGCACCTCAACAGT - UNI31869 - CTTCTGAACT

GCATCATGGACATGGTGGAGAAGACCCGGCGATCCCTCACCGTCCTGCGCCGGTGTCAGGAGGCCGACCGTGAGGAACTCAACCACTGGATCCGGTGCTA

CAGTGACTCTGAGGAGGGGAAGAAGGGCCCTACCCCCATCTCTGCCCGGTCCCTCAACAGCTGCAGTGGCCCTGAGGGGTCTCAGCTAG - UNI31869

 - ATGTTCACCGGGACTTCACGCCCAGGACCCTGTCTGGCTACATGCCTGAAGAGATCTGGAGGAAGGCTG AAGAAGCTGTGAATGAGGTGAAGCGCC

AGGCCATGTCAGAACTACAGAAAGCTGTGTCTGATGCGGAGCGCAAAGCCCATGAACTCATCACCACAGAGCGTGCCAAGATGGAACGAGCCCTGGCGGA

GGCCAAGCGACAGGCCTCGGAGGATGCCCTGACTGTCATCAACCAGCAAGAGGACTCCAGCGAG AGCTGCTGGAACTGCGGGCGCAAGGCCAGCGAGAC

GTGCAGTGGCTGTAACGCCGCCCGCTACTGCGGGTCCTTCTGTCAGCACAAAGACTGGGAGAAACACCATCACGTGTGCGGCCAGAGTCTGCAGGGCCCC

GCGGCTGCAGTGGCTGACCCACTACCTGGACAGCCTGACGCCACTGCCAGCCCCAGCGAAGCCGGCTCGGCAGGGCCCTCTCGTCCCTGCTCTCCGGGGC

CGCCAGGCCCGCTGGACGCTGCTGTGCCCCGCTGACCTCCAGATCTGACACCCAGCCCATGGACGCCATGCCCTGCCAACCTCCTGGCCCCACCGTGGCC

CACCAGTTGCCTGGAGCCATTGCTGCTACTGCTTCTCTCCAAAAGAAAACACAGATCCAACAGAACTGCATCCGTGCAGCCCCAGCTACCTGACAAGGTC

TGCCGGGACCTCTACAGCCTCTCGTCCATCGCAAGCACCCTCAGAAAGCATCGCAGAGCGTCAGACAGTGGCACCAGCAGGAGTGTGGCCAGCTCCGCCG

CTGTCTGTCCCCTCTGTGTCCGTCTCTCTGTGTCCGTCTGTCTTTCTGCGTCTGCCTCTCTCTGTGTGTCTCTCCGTGTCTTTGTCTCCTGCCGTTTCCC

TGACTCTCCGGCGTCTCTGTCTTTGTAAAGTCCACATGATCTCTCTGTCATCAGAGAAACCTAGTTGGTAGCTTTTCTTTTCCATGAAGAACTTTTGGAG

ATTTTGTTTTGTTTTGTTGGCAAACAAGCTACTTAGAAATGGACAAAGAAGACTGTGGGGTTCTCCCCATTCCTCATGAGTAAGGGAAGAAACTGTGATT

TTTCTATCCAGAGTTGCTGTATCGCCCAGCCAGCCCCAGGGGCATCAGCGAGCACACAGCAGAGATAATGAGAGCAACTGCAATTTCCAACTTAAGAAGC

AGCTTTTGTTTCAGGTTTTACTCCTTTAATGTCAAACTCTTTGGCTTTAAGTGAAAAAAAAAAAAAGGAAAAAAAAATCCAAAAAGTTTTTTTTTTTTTT

AAGC
Translation
 MPDSPAEVKTQPRSTPPSMPPPPPTSSQGATRPPSFTPHTH HGEDGPATSLPHGRFHGCLKWSMVCLL LMNGSSHSPTAIHGAPSTPNGFSNGPATS

STASLSTQHLPPACGARQLSKLKRFLTTLQQFGSDISPEIGERVRTLVLGLV NSTLTIEEFHAKLQEATNFPLRPFVIPFLK ANLPLLQRELLHCARL

AKQTPAQYLAQHEQLLLDASATSPVDSSELLLEVNENGKRRTPDR RTKENGSDRDPLHPDHLSKRSCTLSPAQRCSPSNGLPHPTPPPPPHYRLEDMAM

AHHFRDSYRHPDPRELRERHRPLA AIPGSRQEEVIDHRLTEREWAEEWKHLNS - UNI31869 - LLNCIMDMVEKTRRSLTVLRRCQEADREELNH

WIRCYSDSEEGKKGPTPISARSLNSCSGPEGSQLD - UNI31869 - DVHRDFTPRTLSGYMPEEIWRKAE EEAVNEVKRQAMSELQKAVSDAERKA

HELITTERAKMERALAEAKRQASEDALTVINQQEDSSE SCWNCGRKASETCSGCNAARYCGSFCQHKDWEKHHHVCGQSLQGPAAAVADPLPGQPDATA

SPSEAGSAGPSRPCSPGPPGPLDAAVPR
Transcript ENSMUST00000108881
Sequence
GACTCGGTGAGACGCGCGGGCGAGCGCGCGGCAGCAGAGCCGAAAGCACGGCGGCTGGACCCGGCGGCCGCCGAGGCCGAAACCACCCGGGCAGCGTGCG

GGCTTTGTTCCCGCGCTGGGGGCCGAACGCACTCGGCATGGCCCAGGCGGTCGCCCCGCGCGCCCCGACCCCGCCGCGCGCCTGAGCCCCGCGCAGCGCG

AGAAGACAGCGTACGGATCGCCCCCAAGTTATGGAGGTGGCGACCCAGTGAGAAGGAAAAGCCACTTCGGGAGCCGGGTTGCGAGAGAGCTACGGTCCCC

TGGAGCTCCAGACC CTCACAGGAAGGAGAAGGCTGCAGCAATGCCAGACTCCCCGGCTGAAGTGAAGACGCAGCCCCGGTCCACACCCCCCAGCATGCC

GCCCCCACCTCCCACCTCATCCCAGGGAGCCACACGACCACCCTCCTTCACACCTCACACAC TGATGAACGGCAGCAGCCACTCACCCACGGCCATCCA

CGGTGCCCCATCTACACCCAATGGCTTCAGCAACGGCCCAGCCACCTCATCCACGGCCTCGCTCTCCACACAGCACCTGCCCCCGGCGTGCGGGGCACGG

CAGCTCAGCAAGCTTAAGCGTTTCCTCACCACCCTACAGCAGTTTGGCAGTGACATCTCACCTGAGATCGGGGAGCGCGTGCGCACACTGGTGCTGGGCC

TGGTG AACTCAACTCTGACGATCGAAGAGTTTCATGCCAAGCTCCAGGAAGCCACCAACTTTCCACTGAGGCCGTTTGTTATCCCTTTTCTGAAG GCT

AATCTTCCACTGCTGCAGCGTGAGCTCCTGCACTGTGCCCGCCTGGCCAAACAGACACCTGCCCAGTACCTGGCCCAGCACGAACAGCTGCTGCTGGACG

CCAGCGCCACCTCCCCTGTCGACTCGTCTGAGCTCCTGCTGGAAGTCAACGAGAACGGCAAAAGGAGAACACCTGACAG GACCAAAGAGAATGGATCAG

ACCGGGACCCTCTGCACCCCGACCACCTCAGTAAGCGGTCCTGCACCCTGAGCCCCGCCCAGCGCTGCAGCCCCAGCAATGGGCTGCCCCACCCGACGCC

ACCCCCACCCCCGCACTATCGCCTGGAGGACATGGCCATGGCCCACCATTTCCGGGACTCCTACCGCCATCCTGATCCCCGAGAGCTACGGGAACGCCAC

CGGCCCCTGG CCATACCT - UNI31869 - GGTCTCGACAAGAAGAAGTGA
Translation
 MPDSPAEVKTQPRSTPPSMPPPPPTSSQGATRPPSFTPHTL LMNGSSHSPTAIHGAPSTPNGFSNGPATSSTASLSTQHLPPACGARQLSKLKRFLTT

LQQFGSDISPEIGERVRTLVLGLV NSTLTIEEFHAKLQEATNFPLRPFVIPFLK ANLPLLQRELLHCARLAKQTPAQYLAQHEQLLLDASATSPVDSS

ELLLEVNENGKRRTPDR RTKENGSDRDPLHPDHLSKRSCTLSPAQRCSPSNGLPHPTPPPPPHYRLEDMAMAHHFRDSYRHPDPRELRERHRPLA AIP

 - UNI31869 - GLDKKK

For any suggestions or comments, please send an email to unitrap@crg.es