Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000006445 (Epha2)
Chromosomal location
Chr 4: 140857155 - 140885293 (+)
Description
Eph receptor A2 Gene [Source:MGI (curated);Acc:Epha2-001]
RefSeq_dna
NM_010139 
RefSeq_peptide
NP_034269.2 
UniGene
Mm.2581 
MGI
MGI:95278 
Uniprot/SWISSPROT
Q03145 
Uniprot/SPTREMBL
Q3UNI2 
Human Ortholog
ENSG00000142627 (EPHA2)
Omim not available
UniTrap UNI10230
Vector Insertion
Chr 4: 140857350 - 140862428
Public Clones RST009 (baygenomics) GST015 (baygenomics) P086D08 (ggtc) D021A11 (ggtc)
E037B11 (ggtc) G061C12 (ggtc) D039G03 (ggtc) G062E11 (ggtc) P136E01 (ggtc)
(ggtc) D044D11 (ggtc) P063B05 (ggtc) P128C07 (ggtc) P056C09 (ggtc)
IST14816F4 (tigm)
Private Clones OST208550 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9498
Vector Insertion
Chr 4: 140862497 - 140864319
Public Clones RST296 (baygenomics) RST288 (baygenomics) (ggtc) IST10774G3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4399
Vector Insertion
Chr 4: 140864996 - 140872501
Public Clones XP0033 (sanger) AE0250 (sanger) XST075 (baygenomics) GST012 (baygenomics)
RST416 (baygenomics) XST127 (baygenomics) GST092 (baygenomics) GST203 (baygenomics)
PST063 (baygenomics) G029H08 (ggtc) G079C04 (ggtc) G069D06 (ggtc)
IST13605C3 (tigm) IST10774G3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10129
Vector Insertion
Chr 4: 140874513 - 140874837
Public Clones KST109 (baygenomics) XST085 (baygenomics) G054E09 (ggtc) G041C09 (ggtc)
G068A08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9143
Vector Insertion
Chr 4: 140874992 - 140876408
Public Clones RST503 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5603
Vector Insertion
Chr 4: 140876509 - 140877131
Public Clones YTA342 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15570
Vector Insertion
Chr 4: 140877188 - 140877379
Public Clones PST2012-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12329
Vector Insertion
Chr 4: 140877806 - 140877977
Public Clones W092A07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15120
Vector Insertion
Chr 4: 140878040 - 140878117
Public Clones PST12595-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18483
Vector Insertion
Chr 4: 140878651 - 140879327
Public Clones not available
Private Clones OST422668 (lexicon)
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8761
Vector Insertion
Chr 4: 140879522 - 140880146
Public Clones XN869 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10692
Vector Insertion
Chr 4: 140880303 - 140884327
Public Clones M052A06 (ggtc) FHCRC-GT-S4-11H1 (fhcrc)
Private Clones OST331934 (lexicon)
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000006614
Sequence
ATTAAGGACTTGGAGCAGGAGGGTAGAAGTTGTCTCTGTCGGCGGGCGGGCAGGATTGGGGCACCGAGACCGGCGTGCGGACAGCAGGGATCGCGGGGAG

CGAGGGGTGCGGCATGGAGCTCCGGGCAGTCGGTTTCTGCCTGGCGCTGCTGTGGGGTTGCGCGCTGGCGGCCGCGGCGGCACAGGGAAAGGAAG - UN

I10230 - TTGTTTTGTTGGACTTCGCAGCAATGAAGGGAGAGCTCGGCTGGCTCACGCACCCCTATGGCAAAGGG - UNI9498 - TGGGACCTGA

TGCAGAACATCATGGACGACATGCCTATCTACATGTACTCGGTGTGCAACGTGGTATCCGGCGACCAGGACAACTGGCTCCGCACCAACTGGGTGTACCG

GGAGGAGGCCGAGCGCATCTTTATTGAGCTCAAGTTCACGGTGCGAGACTGTAACAGCTTCCCGGGTGGCGCCAGCTCATGCAAAGAGACCTTCAACCTC

TACTATGCAGAGTCAGATGTGGACTATGGCACCAACTTCCAGAAGCGCCAGTTCACCAAGATTGACACCATCGCCCCTGACGAGATCACGGTCAGCAGTG

ACTTCGAGGCTCGCAATGTCAAGCTGAACGTAGAGGAGCGCATGGTGGGGCCCCTTACCCGGAAGGGCTTCTACCTGGCCTTCCAGGACATCGGCGCCTG

CGTGGCGCTGCTCTCCGTTCGCGTCTACTACAAGAAGTGTCCCGAGATGCTGCAGAGCTTGGCTCGCTTCCCCGAGACCATTGCTGTCGCTGTCTCCGAT

ACACAACCCCTGGCCACGGTGGCCGGTACCTGCGTGGACCATGCCGTGGTGCCTTATGGGGGCGAGGGGCCTCTCATGCACTGCACGGTGGATGGCGAGT

GGCTGGTGCCCATCGGGCAGTGCCTGTGCCAGGAAGGCTACGAGAAGGTCGAGGATGCCTGCCGAG - UNI4399 - CCTGTTCTCCAGGATTCTTCA

AGTCTGAGGCATCTGAGAGCCCTTGCCTGGAGTGTCCAGAGCATACCCTGCCATCCACAGAGGGTGCCACCTCCTGCCAGTGTGAAGAAGGCTATTTCAG

GGCACCTGAGGACCCACTGTCCATGTCTTGCACAC GTCCACCCTCTGCCCCCAACTACCTCACGGCCATTGGCATGGGTGCCAAAGTAGAACTGCGTTG

GACAGCTCCCAAGGACACTGGTGGCCGCCAGGACATTGTCTACAGTGTCACTTGCGAACAGTGCTGGCCAGAGTCTGGCGAGTGTGGGCCCTGTGAGGCG

AGCGTGCGCTATTCAGAACCTCCTCACGCCCTGACCCGCACGAGTGTGACAGTCAGTGACCTGGAGCCCCACATGAACTATACCTTCGCTGTCGAAGCAC

GCAATGGTGTCTCAGGCCTGGTGACTAGCCGAAGCTTCCGGACTGCCAGCGTCAGTATTAACCAAACAG AGCCCCCCAAAGTGAGGCTGGAGGACCGAA

GCACCACCTCCCTGAGTGTCACCTGGAGCATCCCGGTGTCACAGCAGAGCCGTGTGTGGAAGTACGAAGTCACCTACCGCAAGAAG - UNI10129 - 

GGGGATGCCAACAGCTATAATGTGCGCCGCACGGAAGGCTTCTCCGTGACCCTGGATGACCTTGCTCCGGATACCACGTACCTGGTGCAGGTGCAGGCGC

TGACGCAGGAGGGCCAGGGAGCCGGCAGCAAAGTGCACGAGTTCCAGACACTGT - UNI9143 - CCACGGAAGGATCTGCCAACATGGCGGTGATCG

GCGGTGTGGCTGTAGGTGTTGTTTTGCTTCTGGTACTGGCAGGAGTTGGCCTCTTCATCCATCGAAG - UNI5603 - GAGGAGGAACCTGCGGGCTC

GCCAGTCCTCTGAGGATGTCCGTTTTTCCAAGTCAG - UNI15570 - AACAACTAAAGCCCCTGAAGACCTATGTGGATCCTCACACTTACGAAGAC

CCCAACCAGGCTGTACTCAAGTTTACCACCGAGATCCACCCATCCTGTGTGGCAAGGCAGAAGGTCATTGGAGCAG GAGAGTTTGGAGAGGTCTATAAA

GGGACGCTGAAGGCATCCTCGGGGAAGAAGGAGATACCGGTGGCCATCAAGACACTGAAAGCGGGCTACACTGAGAAGCAGCGGGTGGACTTCCTGAGCG

AGGCCAGCATCATGGGCCAGTTTAGCCACCACAATATCATCCGCCTGGAGGGCGTGGTCTCTAAAT - UNI12329 - ACAAACCCATGATGATTATC

ACAGAGTACATGGAGAATGGAGCGCTAGACAAGTTCCTTAGG - UNI15120 - GAGAAGGATGGTGAGTTCAGTGTACTTCAGTTGGTGGGCATGCT

GAGGGGTATCGCATCCGGCATGAAGTACCTGGCCAACATGAACTACGTGCACCGGGACCTGGCCGCCCGCAACATCCTCGTCAACAGCAACCTGGTGTGC

AAGGTGTCCGATTTTGGCCTGTCGCGTGTGCTGGAAGATGACCCCGAGGCCACCTACACCACAAGT GGCGGCAAGATCCCTATTCGATGGACAGCCCCA

GAGGCCATTTCCTACCGCAAGTTCACCTCAGCCAGCGATGTGTGGAGCTACGGCATTGTCATGTGGGAAGTGATGACTTATGGCGAACGGCCCTACTGGG

AACTGTCAAACCACGAG - UNI18483 - GTCATGAAAGCCATCAACGACGGCTTCCGGCTCCCTACGCCCATGGACTGCCCTTCAGCCATTTACCAG

CTCATGATGCAGTGCTGGCAGCAAGAGCGCTCCCGCCGACCCAAGTTTGCCGACATCGTTAGCATCCTGGACAAGCTCATCCGAGCCCCCGACTCCCTCA

AGACGCTGGCTGACTTTGATCCCCG - UNI8761 - AGTGTCCATCCGGCTGCCCAGCACCAGCGGCTCGGAGGGAGTCCCCTTCCGTACGGTGTCCG

AGTGGCTGGAGAGCATCAAGATGCAACAGTACACGGAACACTTCATGGTGGCTGGCTACACGGCCATCGAGAAGGTGGTACAGATGTCCAACGA - UNI

10692 - AGACATCAAAAGGATCGGAGTGCGTCTTCCTGGCCACCAGAAGCGTATTGCCTACAGCCTGCTGGGACTCAAGGACCAGGTCAACACAGTGG

GGATTCCTATCTGAGTCCATTGGGGCCGTGCCCAACAATACTTGAAGAGCCACAGTGGTCTCCCTGCCGACCTGGTGCTGGCCCACTGGAACTTTATTTA

TTTCTGTTTCCTCGTCTATGCCTCCCTGAGGACTCTGCAGGGGGCTTTTGAATGACACCCTGGCCTGAGCCTGGGAAACTTGGATGCTGGTCAGGGCTCT

CTTTCCCCTGCAAAGGACCCAGCTAAGCACTTAGCAGTTTGCCATGGCCTTCCCAGCATCCCCTGAGGCTAAAGTTCCACCAAGACCGTCGATATCGACG

AGGGACATTTCCAAACGGACCTCCCCATCTTCATTTGGCCTCCTGAGAAGCCACCTCAGGAGCTGAGGCTAAGCACTAAGCCCAGGACCATATGACTAGG

GCACTGTACGCCCCGCCCCTAGTTAGAGGGTAGGTTTTGGACTTGGCTGGGTGTGGTCACAGCAATCTCCCAGTGCCTTTTACAGACCCAGGGCTCTGCC

CTCCGCCCTCGAGGGCCAGCTTCTTGCTTTCCTAGGGCCCTCTCAGGATGCTTGGCTGTGCTGAGGTTTTTATTAAATATATATTTTATACTTGTGGAAA

GAATGAGTGTGTGGCAGGGACCTTGCCAGGGCTGGAGACAGAGGATCCCCTGCAACAGACATTCCCGGGCTGGGGGCTGGCGGACCTGCAGGAGACTTTC

CGCCAGCCACCCAGTCTCCAGCCCCTTTGGACAAATGTCGCTGTCAGTGTTACAGATTTCTTTTATTGGGTTGTTTTTTTGTTGTATTTTTTGAACCTTA

ACTTATTATTTTTTTTATATTTATTGTTAGAAAATGACTTATTTCTGCTCTGGAATAAAGTTGCAGATGGTTCA
Translation
MELRAVGFCLALLWGCALAAAAAQGKEV - UNI10230 - VVLLDFAAMKGELGWLTHPYGKG - UNI9498 - WDLMQNIMDDMPIYMYSVCNVV

SGDQDNWLRTNWVYREEAERIFIELKFTVRDCNSFPGGASSCKETFNLYYAESDVDYGTNFQKRQFTKIDTIAPDEITVSSDFEARNVKLNVEERMVGPL

TRKGFYLAFQDIGACVALLSVRVYYKKCPEMLQSLARFPETIAVAVSDTQPLATVAGTCVDHAVVPYGGEGPLMHCTVDGEWLVPIGQCLCQEGYEKVED

ACRA - UNI4399 - ACSPGFFKSEASESPCLECPEHTLPSTEGATSCQCEEGYFRAPEDPLSMSCTR RPPSAPNYLTAIGMGAKVELRWTAPKDTG

GRQDIVYSVTCEQCWPESGECGPCEASVRYSEPPHALTRTSVTVSDLEPHMNYTFAVEARNGVSGLVTSRSFRTASVSINQTE EPPKVRLEDRSTTSLS

VTWSIPVSQQSRVWKYEVTYRKK - UNI10129 - GDANSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLS - UNI9143 

- STEGSANMAVIGGVAVGVVLLLVLAGVGLFIHRR - UNI5603 - RRRNLRARQSSEDVRFSKSE - UNI15570 - EQLKPLKTYVDPHTYED

PNQAVLKFTTEIHPSCVARQKVIGAG GEFGEVYKGTLKASSGKKEIPVAIKTLKAGYTEKQRVDFLSEASIMGQFSHHNIIRLEGVVSKY - UNI123

29 - YKPMMIITEYMENGALDKFLR - UNI15120 - EKDGEFSVLQLVGMLRGIASGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLE

DDPEATYTTS GGKIPIRWTAPEAISYRKFTSASDVWSYGIVMWEVMTYGERPYWELSNHE - UNI18483 - VMKAINDGFRLPTPMDCPSAIYQLM

MQCWQQERSRRPKFADIVSILDKLIRAPDSLKTLADFDPR - UNI8761 - RVSIRLPSTSGSEGVPFRTVSEWLESIKMQQYTEHFMVAGYTAIEKV

VQMSNE - UNI10692 - EDIKRIGVRLPGHQKRIAYSLLGLKDQVNTVGIPI

For any suggestions or comments, please send an email to unitrap@crg.es