Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000006456 (Rbm14)
Chromosomal location
Chr 19: 4800925 - 4811603 (-)
Description
RNA binding motif protein 14 Gene [Source:MGI Symbol;Acc:MGI:1929092]
RefSeq_dna
NM_019869 
RefSeq_peptide
NP_063922.2 
UniGene
Mm.276338 
MGI
MGI:1929092 
Uniprot/SWISSPROT
Q8C2Q3 
Uniprot/SPTREMBL
Q62019 
Human Ortholog
ENSG00000173933 (RBM14)
Omim not available
UniTrap UNI5469
Vector Insertion
Chr 19: 4811171 - 4811509
Public Clones CSJ319 (baygenomics) YHC214 (baygenomics) XC270 (baygenomics) CSH640 (baygenomics)
CSH281 (baygenomics) YTA292 (baygenomics) YHB101 (baygenomics) YTC457 (baygenomics)
CSH603 (baygenomics) YHD155 (baygenomics) CSI070 (baygenomics) XG831 (baygenomics)
CSH195 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16349
Vector Insertion
Chr 19: 4804016 - 4811171
Public Clones (sanger) E036B01 (ggtc) CMHD-GT_540F9-5S (cmhd) IST12523B2 (tigm)
IST14504G2 (tigm) IST13633C7 (tigm) IST14820A12 (tigm) IST15072G4 (tigm)
IST14583A2 (tigm)
Private Clones OST462831 (lexicon) OST197615 (lexicon)
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8946
Vector Insertion
Chr 19: 4802813 - 4804016
Public Clones RRE188 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099998
Sequence
ATGAAGATTTTTGTGGGCAATGTCGATGGGGCGGATACGACACCGGAGGAGTTGGCAGCTCTCTTCGCGCCCTATGGCACGGTCATGAGCTGCGCCGTCA

TGAAACAGTTTGCCTTCGTGCACATGCGCGAGAACGCTGGC - UNI5469 - GGTGCGCGCCATCGAGGCCCTGCATGG - UNI5469 - CACGAG

CTGCGTCCAGGTCGCGCGCTCGTGGTGGAGATGTCGCGCCCGAGGCCCCTGAACACTTGGAAGATTTTCGTGGGCAATGTATCGGCTGCATGTACAAGTC

AGGAATTGCGCAGCCTCTTCGAGCGCCGTGGACGCGTCATCGAGTGTGACGTGGTAAAAG - UNI5469 - - UNI8946 - - UNI16349 - AC

TACGCGTTTGTTCACATGGAGAAGGAAGCAGATGCCAAAGCCGCCATCGCGCAGCTCAACGGCAAAGAAGTGAAGGGCAAGCGCATCAACGTGGAACTCT

CAACCAAGGGGCAGAAGAAGGGGCCTGCCCTGGCTATCCAGTCTGGGGACAAGACCAAGAAACCAGGGGCTGGGGACACAGCATTCCCTGGAACTGGTGG

CTTCTCTGCCACCTTCGACTACCAGCAGGCTTTTGGCAACAGCACTGGTGGCTTTGATGGGCAAGCCCGTCAGCCCACACCACCATTCTTTGGTCGCGAC

CGCAGCCCCCTGCGCCGTTCACCTCCTCGAGCCTCTTATGTGGCGCCTCTGACGGCCCAGCCAGCCACCTACCGGGCCCAACCCTCAGTGTCTCTGGGAG

CTGCATATAGGGCCCAGCCTTCCGCCTCTTTGGGTGTTGGCTATCGGACTCAGCCCATGGCAGCTCAGGCAGCTTCTTACCGTGCTCAGCCCTCTGTCTC

CCTTGGGGCCCCATACAGGGGTCAGCTGGCTAGCCCTAGTTCCCAGTCTGCTGCAGCTTCCTCGCTTGGCCCATATGGTGGAGTCCAGCCCTCAGCCTCA

GCCCTTTCCACTTATGGGGGTCAGGCAGCTGCAGCTTCTTCGCTTAATTCCTATGGGGCTCAGGGCTCCTCCCTTGCTTCCTATGGTAACCAGCCATCCT

CTTATGGCGCCCAGGCTGCCTCTTCGTATGGGGTTCGTGCGGCTGCTTCTTCCTATAACACACAAGGAGCAGCTTCTTCCCTAGGTTCCTATGGGGCTCA

AGCAGCCTCCTATGGTGCCCAGTCTGCAGCCTCCTCACTAGCTTATGGAGCCCAGGCAGCGTCTTACAGTGCCCAGCCCTCAGCCTCTTACAGTGCCCAG

TCTGCCCCATATGCTGCACAACAGGCTGCTTCTTATTCTTCCCAGCCTGCTGCTTATGTGGCACAACCAGCCACAGCTGCTGCCTATGCTAGCCAGCCAG

CTGCCTATGCTGCACAAGCCACTACCCCAATGGCTGGTTCCTATGGGGCTCAACCAGTTGTTCAGACCCAGCTGAATAGCTATGGGGCTCAAGCATCTAT

TGGCCTGTCAGGCTCATATGGAGCTCAGTCTGCTGCTGCGGCCACTGGCTCCTATGGGGCGGCAGCTGCTTACGGGGCTCAGCCTTCTGCCACCCTGGCA

 - UNI8946 - CTCCTTACCGCACTCAGTCATCAGCCTCATTGGCTGCTTCCTATGCTGCCCAGCAGCATCCCCAGGCTGCTGCCTCCTACCGTGGCC

AGC GGCAGTGCCTACGATGGGACAGGCCAGCCATCAGCAGCCTACCTGTCTATG CCAGGGGGCCGTTGCCAACGCCAACAGCACCCCGCCGCCCTATG

A
Translation
MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAG - UNI5469 - GARHRGPAW - UNI5469 - HELRPGRALVVEMSRPRP

LNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKD - UNI5469 - - UNI8946 - - UNI16349 - DYAFVHMEKEADAKAAIAQLNGKE

VKGKRINVELSTKGQKKGPALAIQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRSPPRASYVAPLTAQPAT

YRAQPSVSLGAAYRAQPSASLGVGYRTQPMAAQAASYRAQPSVSLGAPYRGQLASPSSQSAAASSLGPYGGVQPSASALSTYGGQAAAASSLNSYGAQGS

SLASYGNQPSSYGAQAASSYGVRAAASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQAASYSAQPSASYSAQSAPYAAQQAASYSSQPAAYVAQP

ATAAAYASQPAAYAAQATTPMAGSYGAQPVVQTQLNSYGAQASIGLSGSYGAQSAAAATGSYGAAAAYGAQPSATLA - UNI8946 - LLTALSHQPH

WLLPMLPSSIPRLLPPTVAS GSAYDGTGQPSAAYLSM PGGRCQRQQHPAAL
Transcript ENSMUST00000113793
Sequence
AGCCATTCCTGTGGAGGACTGCGGGTCGTTCGGACGTTTTGCCTGTCGCTGTAGGAGAGGTCCTGTCTCTCCGAGAAGGCGGTTGCGGCGGCAAAATGAA

GATTTTTGTGGGCAATGTCGATGGGGCGGATACGACACCGGAGGAGTTGGCAGCTCTCTTCGCGCCCTATGGCACGGTCATGAGCTGCGCCGTCATGAAA

CAGTTTGCCTTCGTGCACATGCGCGAGAACGCTGGCGCGGTGCGCGCCATCGAGGCCCTGCATGGCCACGAGCTGCGTCCAGGTCGCGCGCTCGTGGTGG

AGATGTCGCGCCCGAGGCCCCTGAACACTTGGAAGATTTTCGTGGGCAATGTATCGGCTGCATGTACAAGTCAGGAATTGCGCAGCCTCTTCGAGCGCCG

TGGACGCGTCATCGAGTGTGACGTGGTAAAAG - UNI5469 - - UNI8946 - - UNI16349 - ACTACGCGTTTGTTCACATGGAGAAGGAAG

CAGATGCCAAAGCCGCCATCGCGCAGCTCAACGGCAAAGAAGTGAAGGGCAAGCGCATCAACGTGGAACTCTCAACCAAGGGGCAGAAGAAGGGGCCTGC

CCTGGCTATCCAGTCTGGGGACAAGACCAAGAAACCAGGGGCTGGGGACACAGCATTCCCTGGAACTGGTGGCTTCTCTGCCACCTTCGACTACCAGCAG

GCTTTTGGCAACAGCACTGGTGGCTTTGATGGGCAAGCCCGTCAGCCCACACCACCATTCTTTGGTCGCGACCGCAGCCCCCTGCGCCGTTCACCTCCTC

GAGCCTCTTATGTGGCGCCTCTGACGGCCCAGCCAGCCACCTACCGGGCCCAACCCTCAGTGTCTCTGGGAGCTGCATATAGGGCCCAGCCTTCCGCCTC

TTTGGGTGTTGGCTATCGGACTCAGCCCATGGCAGCTCAGGCAGCTTCTTACCGTGCTCAGCCCTCTGTCTCCCTTGGGGCCCCATACAGGGGTCAGCTG

GCTAGCCCTAGTTCCCAGTCTGCTGCAGCTTCCTCGCTTGGCCCATATGGTGGAGTCCAGCCCTCAGCCTCAGCCCTTTCCACTTATGGGGGTCAGGCAG

CTGCAGCTTCTTCGCTTAATTCCTATGGGGCTCAGGGCTCCTCCCTTGCTTCCTATGGTAACCAGCCATCCTCTTATGGCGCCCAGGCTGCCTCTTCGTA

TGGGGTTCGTGCGGCTGCTTCTTCCTATAACACACAAGGAGCAGCTTCTTCCCTAGGTTCCTATGGGGCTCAAGCAGCCTCCTATGGTGCCCAGTCTGCA

GCCTCCTCACTAGCTTATGGAGCCCAGGCAGCGTCTTACAGTGCCCAGCCCTCAGCCTCTTACAGTGCCCAGTCTGCCCCATATGCTGCACAACAGGCTG

CTTCTTATTCTTCCCAGCCTGCTGCTTATGTGGCACAACCAGCCACAGCTGCTGCCTATGCTAGCCAGCCAGCTGCCTATGCTGCACAAGCCACTACCCC

AATGGCTGGTTCCTATGGGGCTCAACCAGTTGTTCAGACCCAGCTGAATAGCTATGGGGCTCAAGCATCTATTGGCCTGTCAGGCTCATATGGAGCTCAG

TCTGCTGCTGCGGCCACTGGCTCCTATGGGGCGGCAGCTGCTTACGGGGCTCAGCCTTCTGCCACCCTGGCAGCTCCTTACCGCACTCAGTCATCAGCCT

CATTGGCTGCTTCCTATGCTGCCCAGCAGCATCCCCAGGCTGCTGCCTCCTACCGTGGCCAGCCGGGCAGTGCCTACGATGGGACAGGCCAGCCATCAGC

AGCCTACCTGTCTATGTCCCAGGGGGCCGTTGCCAACGCCAACAGCACCCCGCCGCCCTATGAGCGTACCCGCCTCTCCCCACCCCGGGCCAGCTACGAC

GATCCCTACAAAAAGGCTGTCGCCATGTCAAAAAGGTACTGTATGCCCCCCCCGCCTCAGCCC CTGGGGCTTAGGGCAAGGGGCTGA
Translation
MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGAVRAIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFE

RRGRVIECDVVKD - UNI5469 - - UNI8946 - - UNI16349 - DYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPALAIQS

GDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRSPPRASYVAPLTAQPATYRAQPSVSLGAAYRAQPSASLGVGY

RTQPMAAQAASYRAQPSVSLGAPYRGQLASPSSQSAAASSLGPYGGVQPSASALSTYGGQAAAASSLNSYGAQGSSLASYGNQPSSYGAQAASSYGVRAA

ASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQAASYSAQPSASYSAQSAPYAAQQAASYSSQPAAYVAQPATAAAYASQPAAYAAQATTPMAGSY

GAQPVVQTQLNSYGAQASIGLSGSYGAQSAAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASYRGQPGSAYDGTGQPSAAYLSM

SQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYCMPPPPQP LGLRARG
Transcript ENSMUST00000006625
Sequence
AGCCATTCCTGTGGAGGACTGCGGGTCGTTCGGACGTTTTGCCTGTCGCTGTAGGAGAGGTCCTGTCTCTCCGAGAAGGCGGTTGCGGCGGCAAAATGAA

GATTTTTGTGGGCAATGTCGATGGGGCGGATACGACACCGGAGGAGTTGGCAGCTCTCTTCGCGCCCTATGGCACGGTCATGAGCTGCGCCGTCATGAAA

CAGTTTGCCTTCGTGCACATGCGCGAGAACGCTGGCGCGGTGCGCGCCATCGAGGCCCTGCATGGCCACGAGCTGCGTCCAGGTCGCGCGCTCGTGGTGG

AGATGTCGCGCCCGAGGCCCCTGAACACTTGGAAGATTTTCGTGGGCAATGTATCGGCTGCATGTACAAGTCAGGAATTGCGCAGCCTCTTCGAGCGCCG

TGGACGCGTCATCGAGTGTGACGTGGTAAAAG - UNI5469 - - UNI8946 - - UNI16349 - ACTACGCGTTTGTTCACATGGAGAAGGAAG

CAGATGCCAAAGCCGCCATCGCGCAGCTCAACGGCAAAGAAGTGAAGGGCAAGCGCATCAACGTGGAACTCTCAACCAAGGGGCAGAAGAAGGGGCCTGC

CCTGGCTATCCAGTCTGGGGACAAGACCAAGAAACCAGGGGCTGGGGACACAGCATTCCCTGGAACTGGTGGCTTCTCTGCCACCTTCGACTACCAGCAG

GCTTTTGGCAACAGCACTGGTGGCTTTGATGGGCAAGCCCGTCAGCCCACACCACCATTCTTTGGTCGCGACCGCAGCCCCCTGCGCCGTTCACCTCCTC

GAGCCTCTTATGTGGCGCCTCTGACGGCCCAGCCAGCCACCTACCGGGCCCAACCCTCAGTGTCTCTGGGAGCTGCATATAGGGCCCAGCCTTCCGCCTC

TTTGGGTGTTGGCTATCGGACTCAGCCCATGGCAGCTCAGGCAGCTTCTTACCGTGCTCAGCCCTCTGTCTCCCTTGGGGCCCCATACAGGGGTCAGCTG

GCTAGCCCTAGTTCCCAGTCTGCTGCAGCTTCCTCGCTTGGCCCATATGGTGGAGTCCAGCCCTCAGCCTCAGCCCTTTCCACTTATGGGGGTCAGGCAG

CTGCAGCTTCTTCGCTTAATTCCTATGGGGCTCAGGGCTCCTCCCTTGCTTCCTATGGTAACCAGCCATCCTCTTATGGCGCCCAGGCTGCCTCTTCGTA

TGGGGTTCGTGCGGCTGCTTCTTCCTATAACACACAAGGAGCAGCTTCTTCCCTAGGTTCCTATGGGGCTCAAGCAGCCTCCTATGGTGCCCAGTCTGCA

GCCTCCTCACTAGCTTATGGAGCCCAGGCAGCGTCTTACAGTGCCCAGCCCTCAGCCTCTTACAGTGCCCAGTCTGCCCCATATGCTGCACAACAGGCTG

CTTCTTATTCTTCCCAGCCTGCTGCTTATGTGGCACAACCAGCCACAGCTGCTGCCTATGCTAGCCAGCCAGCTGCCTATGCTGCACAAGCCACTACCCC

AATGGCTGGTTCCTATGGGGCTCAACCAGTTGTTCAGACCCAGCTGAATAGCTATGGGGCTCAAGCATCTATTGGCCTGTCAGGCTCATATGGAGCTCAG

TCTGCTGCTGCGGCCACTGGCTCCTATGGGGCGGCAGCTGCTTACGGGGCTCAGCCTTCTGCCACCCTGGCAGCTCCTTACCGCACTCAGTCATCAGCCT

CATTGGCTGCTTCCTATGCTGCCCAGCAGCATCCCCAGGCTGCTGCCTCCTACCGTGGCCAGCCGGGCAGTGCCTACGATGGGACAGGCCAGCCATCAGC

AGCCTACCTGTCTATGTCCCAGGGGGCCGTTGCCAACGCCAACAGCACCCCGCCGCCCTATGAGCGTACCCGCCTCTCCCCACCCCGGGCCAGCTACGAC

GATCCCTACAAAAAGGCTGTCGCCATGTCAAAAAG GTATGGTTCCGACCGGCGTTTAGCCGAGCTCTCTGATTACCGCCGTTTATCAGAGTCGCAGCTT

TCGTTCCGCCGCTCGCCGACAAAGTCCTCGCTGGATTACCGTCGCCTGCCCGATGCCCATTCCGATTACGCACGCTATTCGGGCTCCTATAATGATTACC

TGCGGGCAGCTCAGATGCACTCTGGCTACCAGCGCCGCATGTAGGGCCATCCTGGGGATGGGGCACCACAGGAAGGGAGAGAGAGGAAGAGGTAGGGTAG

GGTGCAGACCCAGGTTATCACCACCCTCTCTCATACCTCTCCCAATGGTGGCTTTTCATTCCCTCCCTCTATCATGTGGGCCTTCCCCAGGAGAGGACCC

TTTTGTGTTTGGCAGTAACCTGCTTTGTTTCTTTGCCTCAGCAGCACATCTTGCTACTGGCTTTAGATCTGTGGTTTTCCCTCTACCCAGCCATCTCCCC

AGAATGGGAATTTCTTTTATATTTTAATTTTTTTCCTGGCTCCCTTTTATTTTTGTGCGCGATACTTAAGGTTGTTTGGAGGTGATACAACCGACAGCTG

ATGTCAGGCGGCGCGTTTTTCTTTTTAGATGCGAGGGAGGCCAGGAAAGGGTTACTTTAGCTATTTCCTCTGTGCCCAGCTATGCCAGCAGTCCAGGGGC

CCTGCCTGTCCTTCTGTAGAGGCTGTTGAGACTGAGATCCTGTGGGACAGTCAGTTGGTCCGTGTCCAAATCCCCGCTTACCACTGATGTTTTAGCTGAT

GGTGACTGGCATAGTCCCAATTCCCTATCTCTCCAAGTAGGTGGTGTTAGAAATCTTAATTCTTTTCCCTTCTTTTGTATGGACTACAAATAAAACTTGG

GGCGATTCGTGGTTTGG
Translation
MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGAVRAIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFE

RRGRVIECDVVKD - UNI5469 - - UNI8946 - - UNI16349 - DYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPALAIQS

GDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRSPPRASYVAPLTAQPATYRAQPSVSLGAAYRAQPSASLGVGY

RTQPMAAQAASYRAQPSVSLGAPYRGQLASPSSQSAAASSLGPYGGVQPSASALSTYGGQAAAASSLNSYGAQGSSLASYGNQPSSYGAQAASSYGVRAA

ASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQAASYSAQPSASYSAQSAPYAAQQAASYSSQPAAYVAQPATAAAYASQPAAYAAQATTPMAGSY

GAQPVVQTQLNSYGAQASIGLSGSYGAQSAAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASYRGQPGSAYDGTGQPSAAYLSM

SQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKR RYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYARYSGSYNDYLRAA

QMHSGYQRRM

For any suggestions or comments, please send an email to unitrap@crg.es