Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000006575 (Rundc3a)
Chromosomal location
Chr 11: 102254717 - 102263867 (+)
Description
RUN domain containing 3A Gene [Source:MGI (curated);Acc:Rundc3a-001]
RefSeq_dna
NM_016759 
RefSeq_peptide
NP_058039.1 
UniGene
Mm.422241 
MGI
MGI:1858752 
Uniprot/SWISSPROT
O08576 
Human Ortholog
ENSG00000108309 (RUNDC3A)
Omim not available
UniTrap UNI37971
Vector Insertion
Chr 11: 102254716 - 102255097
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31193
Vector Insertion
Chr 11: 102255097 - 102258884
Public Clones IST12331B3 (tigm) IST12331C2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22454
Vector Insertion
Chr 11: 102259001 - 102259398
Public Clones not available
Private Clones OST296564 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000006750
Sequence
ATGGAAGCGAGCTTTGTCCAGACCACCATGGCTCTGGGGCTGCCCTCCAAGAAAGCATCTTCCCGCAACGTGATCGTGGAGCGCAGGAACCTGATCACCG

TGTGCAG - UNI31193 - GTTCTCTGTGAAAACCCTGCTAGAGAAGTACACAGCAGAACCCATTGATGACTCTTCCGAGGAGTTTGTTAATTTCGCA

GCCATTTTAGAGCAGATCCTCAGCCACCGATTTAAAG - UNI22454 - CTTGTGCCCCAGCAGGGCCAGCGAGCTGGTTCAGCTCAGATGGACAACG

GGGCTTCTGGGACTACATCCGGCTGGCCTGCAGCAAAGTGCCCAACAACTGTGTGAGCAGCATTGAGAACATGGAGAACATCAGCACAGCTAGAGCCAAG

 GGCCGGGCGTGGATCCGGGTGGCCCTGATGGAGAAGCGTATGTCGGAATACATCACCACAGCTCTTCGGGACAACCGAACTACCAG ACGGTTCTATGA

CTCCGGAGCCATCATGCTGCGGGAGGAAGCCACTGTCCTCACTGGGATGCTGATCGGGCTCAGCGCCATCGACTTCAG CTTCTGTCTAAAGGGCGAAGT

TCTGGATGGGAAGACACCGGTGGTCATCGATTACACACCCTACCTAAAATTCACCCAAAG CTACGACTACCTGACGGATGAGGAGGAGAGGCACAGTGC

CGAGAGCAGCACCAGCGAGGACAACTCACCAGAGCACCCCTACCTGCCTCTCGTCACCGATGAAGACAGTTGGTACAACAAGTGGCACAAGATGGAACAG

AAGTTTCGCATTGTCTACGCACAGAAG GGATACCTGGAGGAGCTGGTGCGGCTGCGCGAGTCGCAGCTGAAGGACTTGGAGGCGGAGAACCGGCGGCTG

CAGCTGCAGCTGGAGGAGGCCGCGGCACAAAATCAGCGTGAGAAGCGGGAGCTGGAAGGCGTGATCCTGGAGCTGCAGGAGCAGCT GACAGGTCTGATC

CCCGGTGACCATGCCCCCCTGGCCCAGGGTTCCAAGGAGCTCACCACATCCCTAGTCAACCAGTGGCCCTCCCTGAGCACACTTCATAGGCCCGAGGGTG

CCAGCAACTCCAAGCTATATCGGAG ACACAGCTTCATGAGCACGGAGCCGCTGTCTGCAGAGGCCAGCCTGAGCTCAGACTCCCAGCGCCTGGGAGAGG

CCAAGAGGGACGAGGAACCCTGGGGCCCCATCG GGAAGGACCCCACGCCCTCCATGCTGGGCCTCTGCGGCTCCCTGGCCTCCATCCCCAGCTGCAAGT

CCCTGGCAAGCTTCAAATCCAACGAATGCCTGGTGAGCGACAGCCCTGAGGGCAGCCCGGCGCTCAGCCCCAGCTGAGGAGCACCAAGGGCAACACCAGC

CCCACCTGCCAGGGGCCATGGACAACTGCCACCTTATGAGTCCCCCAACCCAGGCCACCCTTCAAGAACACCACCAACCTAGCCTCGGGTCTCTAGGGAA

AGATGACCCAAGCCTCTTTCCTGCTTCAGCTTCCTGCCAAGGAGGCAGGAGCTGCATGGGAAGTGGTGGGGCCACGAGGGACACCCAGATTACAGATCCT

CAGTCCCCTGGGGACAGCGCTCCATTCTGGTGGCTCTGAAGGCTGCCTGGTTCCTTCTGATTTCTTCCACACCTGCCTCAGGAGCAGGTGGTCCAGCCCT

GGCATTCCTGCTGCCCTGCCTCTGGTCTAACCCTGTGTACCCTCTGAAGTCACCCTTCCTTGGTACCTATGTGGGGAGAGATTAGGCAAATAAAAACCAG

AGGACTG
Translation
MEASFVQTTMALGLPSKKASSRNVIVERRNLITVCR - UNI31193 - RFSVKTLLEKYTAEPIDDSSEEFVNFAAILEQILSHRFKA - UNI2245

4 - ACAPAGPASWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENISTARAK GRAWIRVALMEKRMSEYITTALRDNRTTR RRFYDSGAIMLREEA

TVLTGMLIGLSAIDFS SFCLKGEVLDGKTPVVIDYTPYLKFTQS SYDYLTDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYNKWHKMEQKFRIVYA

QK GYLEELVRLRESQLKDLEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQL LTGLIPGDHAPLAQGSKELTTSLVNQWPSLSTLHRPEGASNSK

LYRR RHSFMSTEPLSAEASLSSDSQRLGEAKRDEEPWGPIG GKDPTPSMLGLCGSLASIPSCKSLASFKSNECLVSDSPEGSPALSPS
Transcript ENSMUST00000107105
Sequence
TGCCGGGGGAGGGAGCAAAGGGGCCGGCCTTAGGCGTCGAGGCCGAGGGATGGCAGTGAAGAAGACGAAGGGCCCCCGGGGGCAGACGGCCCAGCCGTGA

TCCTGCGAGGCGGGCCGGGGCGCCGGGTGGGGTGGGGGGCAGCGGGCGGCGACAGCAGTGGCCGCACATCTGGATGGAAGCGAGCTTTGTCCAGACCACC

ATGGCTCTGGGGCTGCCCTCCAAGAAAGCATCTTCCCGCAACGTGATCGTGGAGCGCAGGAACCTGATCACCGTGTGCAG - UNI31193 - GTTCTC

TGTGAAAACCCTGCTAGAGAAGTACACAGCAGAACCCATTGATGACTCTTCCGAGGAGTTTGTTAATTTCGCAGCCATTTTAGAGCAGATCCTCAGCCAC

CGATTTAAAG - UNI22454 - CTTGTGCCCCAGCAGGGCCAGCGAGCTGGTTCAGCTCAGATGGACAACGGGGCTTCTGGGACTACATCCGGCTGGC

CTGCAGCAAAGTGCCCAACAACTGTGTGAGCAGCATTGAGAACATGGAGAACATCAGCACAGCTAGAGCCAAG GGCCGGGCGTGGATCCGGGTGGCCCT

GATGGAGAAGCGTATGTCGGAATACATCACCACAGCTCTTCGGGACAACCGAACTACCAG ACGGTTCTATGACTCCGGAGCCATCATGCTGCGGGAGGA

AGCCACTGTCCTCACTGGGATGCTGATCGGGCTCAGCGCCATCGACTTCAG CTTCTGTCTAAAGGGCGAAGTTCTGGATGGGAAGACACCGGTGGTCAT

CGATTACACACCCTACCTAAAATTCACCCAAAG CTACGACTACCTGACGGATGAGGAGGAGAGGCACAGTGCCGAGAGCAGCACCAGCGAGGACAACTC

ACCAGAGCACCCCTACCTGCCTCTCGTCACCGATGAAGACAGTTGGTACAACAAGTGGCACAAGATGGAACAGAAGTTTCGCATTGTCTACGCACAGAAG

 GGATACCTGGAGGAGCTGGTGCGGCTGCGCGAGTCGCAGCTGAAGGACTTGGAGGCGGAGAACCGGCGGCTGCAGCTGCAGCTGGAGGAGGCCGCGGCA

CAAAATCAGCGTGAGAAGCGGGAGCTGGAAGGCGTGATCCTGGAGCTGCAGGAGCAGCT GCCTGATCCCCCTCCCCCTCCCAGGACAGGTCTGATCCCC

GGTGACCATGCCCCCCTGGCCCAGGGTTCCAAGGAGCTCACCACATCCCTAGTCAACCAGTGGCCCTCCCTGAGCACACTTCATAGGCCCGAGGGTGCCA

GCAACTCCAAGCTATATCGGAG ACACAGCTTCATGAGCACGGAGCCGCTGTCTGCAGAGGCCAGCCTGAGCTCAGACTCCCAGCGCCTGGGAGAGGCCA

AGAGGGACGAGGAACCCTGGGGCCCCATCG GAAGCTCAGAACCAAATTAGTGGCTCCCTCTGAGCGAATGCCCAGGACTTCAACGCATGCATTTTGTGT

TGACCCCTCCTTGGTTACTCCCTTCCTAGTTTCTTCCCCTATGCCTGGACCTCCTGCCTTTTTTTTTTTTAAATACATAGATATATATTATATTGTATTG

GATAACTCGACTTTGAGACGAGGCAGGCTTTGGACATGTAACTCACCACACTGTGTTTGTGACTGTGTGTGTCTCCCCACCAGACTGTGAGCTCCGTGAG

GGCAGGGACCATGTCTTGTCCATTCTCTGTATCCCCAGAGTGTGAAATAGAGCAAATGCTCACTGTGTGCTTAATAAATGGACAAAGAAAGGCTG
Translation
MEASFVQTTMALGLPSKKASSRNVIVERRNLITVCR - UNI31193 - RFSVKTLLEKYTAEPIDDSSEEFVNFAAILEQILSHRFKA - UNI2245

4 - ACAPAGPASWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENISTARAK GRAWIRVALMEKRMSEYITTALRDNRTTR RRFYDSGAIMLREEA

TVLTGMLIGLSAIDFS SFCLKGEVLDGKTPVVIDYTPYLKFTQS SYDYLTDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYNKWHKMEQKFRIVYA

QK GYLEELVRLRESQLKDLEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQL LPDPPPPPRTGLIPGDHAPLAQGSKELTTSLVNQWPSLSTLHR

PEGASNSKLYRR RHSFMSTEPLSAEASLSSDSQRLGEAKRDEEPWGPIG GSSEPN
Transcript ENSMUST00000107102
Sequence
GGCCGAGGAGGGGGGACGGGCGACTGGGGGAGGGGGTGACGAGCTCCGGCTCAGCACCTCGGAGAGCTCCCTCCCCGGCCTTGTTTTGCTCCGGAATCGC

TGCCGGGGGAGGGAGCAAAGGGGCCGGCCTTAGGCGTCGAGGCCGAGGGATGGCAGTGAAGAAGACGAAGGGCCCCCGGGGGCAGACGGCCCAGCCGTGA

TCCTGCGAGGCGGGCCGGGGCGCCGGGTGGGGTGGGGGGCAGCGGGCGGCGACAGCAGTGGCCGCACATCTGGATGGAAGCGAGCTTTGTCCAGACCACC

ATGGCTCTGGGGCTGCCCTCCAAGAAAGCATCTTCCCGCAACGTGATCGTGGAGCGCAGGAACCTGATCACCGTGTGCAG - UNI31193 - GTTCTC

TGTGAAAACCCTGCTAGAGAAGTACACAGCAGAACCCATTGATGACTCTTCCGAGGAGTTTGTTAATTTCGCAGCCATTTTAGAGCAGATCCTCAGCCAC

CGATTTAAAG - UNI22454 - CTTGTGCCCCAGCAGGGCCAGCGAGCTGGTTCAGCTCAGATGGACAACGGGGCTTCTGGGACTACATCCGGCTGGC

CTGCAGCAAAGTGCCCAACAACTGTGTGAGCAGCATTGAGAACATGGAGAACATCAGCACAGCTAGAGCCAAG GGCCGGGCGTGGATCCGGGTGGCCCT

GATGGAGAAGCGTATGTCGGAATACATCACCACAGCTCTTCGGGACAACCGAACTACCAG ACGGTTCTATGACTCCGGAGCCATCATGCTGCGGGAGGA

AGCCACTGTCCTCACTGGGATGCTGATCGGGCTCAGCGCCATCGACTTCAG CTTCTGTCTAAAGGGCGAAGTTCTGGATGGGAAGACACCGGTGGTCAT

CGATTACACACCCTACCTAAAATTCACCCAAAG CTACGACTACCTGACGGATGAGGAGGAGAGGCACAGTGCCGAGAGCAGCACCAGCGAGGACAACTC

ACCAGAGCACCCCTACCTGCCTCTCGTCACCGATGAAGACAGTTGGTACAACAAGTGGCACAAGATGGAACAGAAGTTTCGCATTGTCTACGCACAGAAG

 GGATACCTGGAGGAGCTGGTGCGGCTGCGCGAGTCGCAGCTGAAGGACTTGGAGGCGGAGAACCGGCGGCTGCAGCTGCAGCTGGAGGAGGCCGCGGCA

CAAAATCAGCGTGAGAAGCGGGAGCTGGAAGGCGTGATCCTGGAGCTGCAGGAGCAGCT GACAGGTCTGATCCCCGGTGACCATGCCCCCCTGGCCCAG

GGTTCCAAGGAGCTCACCACATCCCTAGTCAACCAGTGGCCCTCCCTGAGCACACTTCATAGGCCCGAGGGTGCCAGCAACTCCAAGCTATATCGGAG A

CACAGCTTCATGAGCACGGAGCCGCTGTCTGCAGAGGCCAGCCTGAGCTCAGACTCCCAGCGCCTGGGAGAGGCCAAGAGGGACGAGGAACCCTGGGGCC

CCATCG GAAGCTCAGAACCAAATTAGTGGCTCCCTCTGAGCGAATGCCCAGGACTTCAACGCATGCATTTTGTGTTGACCCCTCCTTGGTTACTCCCTT

CCTAGTTTCTTCCCCTATGCCTGGACCTCCTGCCTTTTTTTTTTTTAAATACATAGATATATATTATATTGTATTGGATAACTCGACTTTGAGACGAGGC

AGGCTTTGGACATGTAACTCACCACACTGTGTTTGTGACTGTGTGTGTCTCCCCACCAGACTGTGAGCTCCGTGAGGGCAGGGACCATGTCTTGTCCATT

CTCTGTATCCCCAGAGTGTGAAATAGAGCAAATGCTCACTGTGTGCTTAATAAATGGACAAAGAAAGGCTGAA
Translation
MEASFVQTTMALGLPSKKASSRNVIVERRNLITVCR - UNI31193 - RFSVKTLLEKYTAEPIDDSSEEFVNFAAILEQILSHRFKA - UNI2245

4 - ACAPAGPASWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENISTARAK GRAWIRVALMEKRMSEYITTALRDNRTTR RRFYDSGAIMLREEA

TVLTGMLIGLSAIDFS SFCLKGEVLDGKTPVVIDYTPYLKFTQS SYDYLTDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYNKWHKMEQKFRIVYA

QK GYLEELVRLRESQLKDLEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQL LTGLIPGDHAPLAQGSKELTTSLVNQWPSLSTLHRPEGASNSK

LYRR RHSFMSTEPLSAEASLSSDSQRLGEAKRDEEPWGPIG GSSEPN
Transcript ENSMUST00000107103
Sequence
GGCCGAGGAGGGGGGACGGGCGACTGGGGGAGGGGGTGACGAGCTCCGGCTCAGCACCTCGGAGAGCTCCCTCCCCGGCCTTGTTTTGCTCCGGAATCGC

TGCCGGGGGAGGGAGCAAAGGGGCCGGCCTTAGGCGTCGAGGCCGAGGGATGGCAGTGAAGAAGACGAAGGGCCCCCGGGGGCAGACGGCCCAGCCGTGA

TCCTGCGAGGCGGGCCGGGGCGCCGGGTGGGGTGGGGGGCAGCGGGCGGCGACAGCAGTGGCCGCACATCTGGATGGAAGCGAGCTTTGTCCAGACCACC

ATGGCTCTGGGGCTGCCCTCCAAGAAAGCATCTTCCCGCAACGTGATCGTGGAGCGCAGGAACCTGATCACCGTGTGCAG - UNI31193 - GTTCTC

TGTGAAAACCCTGCTAGAGAAGTACACAGCAGAACCCATTGATGACTCTTCCGAGGAGTTTGTTAATTTCGCAGCCATTTTAGAGCAGATCCTCAGCCAC

CGATTTAAAG - UNI22454 - GGCCAGCGAGCTGGTTCAGCTCAGATGGACAACGGGGCTTCTGGGACTACATCCGGCTGGCCTGCAGCAAAGTGCC

CAACAACTGTGTGAGCAGCATTGAGAACATGGAGAACATCAGCACAGCTAGAGCCAAG GGCCGGGCGTGGATCCGGGTGGCCCTGATGGAGAAGCGTAT

GTCGGAATACATCACCACAGCTCTTCGGGACAACCGAACTACCAG ACGGTTCTATGACTCCGGAGCCATCATGCTGCGGGAGGAAGCCACTGTCCTCAC

TGGGATGCTGATCGGGCTCAGCGCCATCGACTTCAG CTTCTGTCTAAAGGGCGAAGTTCTGGATGGGAAGACACCGGTGGTCATCGATTACACACCCTA

CCTAAAATTCACCCAAAG CTACGACTACCTGACGGATGAGGAGGAGAGGCACAGTGCCGAGAGCAGCACCAGCGAGGACAACTCACCAGAGCACCCCTA

CCTGCCTCTCGTCACCGATGAAGACAGTTGGTACAACAAGTGGCACAAGATGGAACAGAAGTTTCGCATTGTCTACGCACAGAAG GGATACCTGGAGGA

GCTGGTGCGGCTGCGCGAGTCGCAGCTGAAGGACTTGGAGGCGGAGAACCGGCGGCTGCAGCTGCAGCTGGAGGAGGCCGCGGCACAAAATCAGCGTGAG

AAGCGGGAGCTGGAAGGCGTGATCCTGGAGCTGCAGGAGCAGCT GACAGGTCTGATCCCCGGTGACCATGCCCCCCTGGCCCAGGGTTCCAAGGAGCTC

ACCACATCCCTAGTCAACCAGTGGCCCTCCCTGAGCACACTTCATAGGCCCGAGGGTGCCAGCAACTCCAAGCTATATCGGAG ACACAGCTTCATGAGC

ACGGAGCCGCTGTCTGCAGAGGCCAGCCTGAGCTCAGACTCCCAGCGCCTGGGAGAGGCCAAGAGGGACGAGGAACCCTGGGGCCCCATCG GAAGCTCA

GAACCAAATTAGTGGCTCCCTCTGAGCGAATGCCCAGGACTTCAACGCATGCATTTTGTGTTGACCCCTCCTTGGTTACTCCCTTCCTAGTTTCTTCCCC

TATGCCTGGACCTCCTGCCTTTTTTTTTTTTAAATACATAGATATATATTATATTGTATTGGATAACTCGACTTTGAGACGAGGCAGGCTTTGGACATGT

AACTCACCACACTGTGTTTGTGACTGTGTGTGTCTCCCCACCAGACTGTGAGCTCCGTGAGGGCAGGGACCATGTCTTGTCCATTCTCTGTATCCCCAGA

GTGTGAAATAGAGCAAATGCTCACTGTGTGCTTAATAAATGGACAAAGAAAGGCTGAA
Translation
MEASFVQTTMALGLPSKKASSRNVIVERRNLITVCR - UNI31193 - RFSVKTLLEKYTAEPIDDSSEEFVNFAAILEQILSHRFKG - UNI2245

4 - GPASWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENISTARAK GRAWIRVALMEKRMSEYITTALRDNRTTR RRFYDSGAIMLREEATVLTG

MLIGLSAIDFS SFCLKGEVLDGKTPVVIDYTPYLKFTQS SYDYLTDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYNKWHKMEQKFRIVYAQK GY

LEELVRLRESQLKDLEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQL LTGLIPGDHAPLAQGSKELTTSLVNQWPSLSTLHRPEGASNSKLYRR 

RHSFMSTEPLSAEASLSSDSQRLGEAKRDEEPWGPIG GSSEPN

For any suggestions or comments, please send an email to unitrap@crg.es