Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000006599 (Gtf2h1)
Chromosomal location
Chr 7: 54051473 - 54079167 (+)
Description
general transcription factor II H, polypeptide 1 Gene [Source:MGI (curated);Acc:Gtf2h1-001]
RefSeq_dna
NM_008186 
RefSeq_peptide
NP_032212.3 
UniGene
Mm.22700 
MGI
MGI:1277216 
Uniprot/SWISSPROT
Q9DBA9 
Uniprot/SPTREMBL
Q7TPY0 
Human Ortholog
ENSG00000110768 (GTF2H1)
Omim not available
UniTrap UNI13524
Vector Insertion
Chr 7: 54052836 - 54057041
Public Clones D136D05 (ggtc) D037G10 (ggtc) E115A06 (ggtc) CMHD-GT_301D12-3 (cmhd) IST15051G1 (tigm)
IST14529A8 (tigm) IST14155G10 (tigm)
Private Clones OST455206 (lexicon) OST442501 (lexicon) OST389533 (lexicon) OST382464 (lexicon)
OST378643 (lexicon) OST377580 (lexicon) OST367379 (lexicon) OST357041 (lexicon)
OST333927 (lexicon) OST333054 (lexicon) OST331507 (lexicon) OST326792 (lexicon)
OST326321 (lexicon) OST291551 (lexicon) OST286157 (lexicon) OST278114 (lexicon)
OST266183 (lexicon) OST263224 (lexicon) OST234964 (lexicon) OST204357 (lexicon)
OST175052 (lexicon) OST171672 (lexicon) OST148612 (lexicon) OST141481 (lexicon)
OST115742 (lexicon) OST38040 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24556
Vector Insertion
Chr 7: 54059380 - 54060330
Public Clones not available
Private Clones OST215364 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37784
Vector Insertion
Chr 7: 54064250 - 54067801
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1713
Vector Insertion
Chr 7: 54071845 - 54072266
Public Clones CG0748 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7830
Vector Insertion
Chr 7: 54072383 - 54074491
Public Clones RRM391 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000006774
Sequence
CACGTGCCCTCAGCGCCCTCGCAGCCAGCGATGGAGGCGAGACCCCCCGGCAACAGAGGCGGTGGCGACGGCTGCGGCCGCAGGGGTTCAGCCTCCTCCG

TGCAGCGGCTGTGAGAAGCGCGGCGGAGGCAGATCCGACGGGACGCGCTTCCCGCGCCCCAGACCAGAGACCGTAGCTCCCACCTG - UNI13524 - 

CACCTTATAGCCATCATGGCGACTTCATCAGAAGAAGTGTTGCTGATTGTGAAGAAGGTTCGTCAGAAGAAGCAGGATGGAGCACTGTACCTCATGGCAG

AGAGAATTGCTTGGGCACCTGAAGGCAAAGACAGATTTACAATCAGCCATATGTATGCAGATATTAAAT GCCAGAAAATCAGTCCAGAGGGAAAAGCTA

AAATACAACTTCAGCTGGTCCTGCATGCAGGGGACACAACAAACTTCCATTTTTCCAACGAAAGCACGGCAGTGAAAGAACGGGATGCAGTGAAGGACCT

CCTTCAGCAGCTGCTGCCCAAGTTCAAGCGGAAAGCTAATAAAGAGCTGGAGGAGAAGAACAG - UNI24556 - AATGCTCCAAGAAGATCCTGTTT

TATTCCAACTCTATAAAGACCTTGTTGTGAGCCAAGTGATCAGTGCTGAGGAATTCTGGGCCAATCGTTTAAATGTGAATGCAACAGATAGTTCTACATC

CAGTCACAAGCAGGATGTTGGTATTTCTGCAGCATTTCTG GCTGATGTCCGGCCCCAAACGGATGGCTGTAATGGTCTGAGATATAATTTAACTTCTGA

TATCATTGAATCTATATTTAGGACCTATCCAGCAG TAAAAATGAAATATGCAGAAACTGTACCACACAACATGACAGAAAAGGAGTTCTGGACACGCTT

TTTCCAGTCCCATTATTTTCACAGGGACCGACTAAATACAGGATCGAAGGACCTCTTTGCAGAATGTGCCAAAATAGATGAGAAGG GATTAAAAACAAT

GGTTTCATTAGGAGTGAAAAACCCAATGCTAGATTTGACATCGTTGGAAGATAAGCCATTAGACGAG GGCTATGGCATTTCCTCTGTGCCATCTACTTC

CAATTCCAAATCCATAAAGGAGAATAGTAATGCTGCCATCATCAAAAGGTTTAACCACCACAGTGCCATGGTCCTGGCTGCTGGTCTCAGGAAACA ACA

AGCACAAAATGGACAGAATGGTGAGCCCAGCAGCGTGGATGGGAATTCTGGGGATACAGACTGCTTTCAGCCAGCAGTCAAAAGG GCAAAGTTGCAGGA

GTCCATTGAATATGAAGACTTGGGAAACAACAATTCTGTGAAAACGATTGCACTGAATCTCAAGAAGTCAGACAG GTATTACCATGGTCCTACTCCAAT

TCAGTCACTGCAGTATGCAACAAGTCAGGACATTATTAACTCTTTTCAAAGTATTAGACAAGAAATGGAAGCTTACACACCCAAGTTAACTCAG GTTCT

CTCAAGCAGTGCTGCTAGTAGCACCATCACAGCCCTGTCACCTGGAGGAGCTCTTATGCAGGGAGGGACACAGCAAGCCGTAAACC - UNI1713 - A

GATGGTGCCAAACGATATTCAGTCTGAATTGAAACACTTGTATGTGGCTGTTGGGGAACTTCTGCGGCATTTTTGGTCTTGCTTTCCTGTTAATACACCA

TTCCTAGAAGAAAAG - UNI7830 - GTAGTGAAAATGAAGAGTAATTTGGAACGGTTCCAAGTTACAAAGCTCTGCCCATTCCAAGAAAAGATTCGG

AGGCAGTATTTAAGCACAAAT CTGGTAAGTCACATAGAAGAGATGCTGCAGACAGCCTACAACAAGCTCCACGCGTGGCAATCCCGGCGCCTGATGAAG

AAGACGTGAAGCGTTTATGGTGCTCACAGGTTTTGTGGGTTGAAAAAAAACTTACCTGCAGTCACTCTGGAAACCTGGCTGAAGACAAGCAGATGCTCAC

ACCGGGGGAAACATCTGCAGCACGCCCGCCGACTCCCAGAGCTGATGCTGTTGTACTTGCACATGAAAACTGAAACAGAAGGAAGGGACGGGATTCACCT

AACTCTGGGGAGGGAAACCAAGGCAGAACCAAAATGAGCTAAGTTGCAAATATATATGTATGTGTACATGTATATGTATTTAAAGACTGTTTACTGCAGT

TACTCAGGAACTGCTTTTCATTCACGTTAAGCTGCTTTCAAAATTTAAGAAAAAAAAATAACTAAAAGAAAAAAATACTTAAAGGGTGCATTGATAAAAT

CTAAGTTTTTCAGTTTTGTTTTCTGGGTAAATTTTTTTCCCTAAGTTTGTGGCACAGGGTAGCCCTAAGAATCCTTCCTCAGACCCACACTGGGATCCTC

AAATGTTACTAAATTCTAGTTGTTCCTTACTTCAGCATGTTAAAGAGAGTGCTTTAAATAAGGCAGAGGGATGCTGTTGCTCAGCCATCAGGAAACAGTT

GTCAGAAGACTCCACTAGTCCTGTGTTTCCTACGGAAATAAGTGTGGCACTGAAGCCTGTGTTCTGAGTCCCCAAGTAGAAGGCACATGTGCGGGAGTCG

TGGTCAGTGCAGGACGTCGTCAGGAGACTGATGCTGCATGGGTTTCTTGGGTGCAAATGTATATTGCTGAGAATTTTTTTAAAGATGGCATGTGCTTTGA

AAAAAAATTGCATTTTTAAGAATTTAAAAATCTTATAAGTGAGAAATATAAGAATTGCTTATTTTCACCTGTTTAGAAGAAATAAAGAAAGTTTCTC
Translation
 - UNI13524 - MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKC CQKISPEGKAKIQLQLVLHAGDTTNFHFSNEST

AVKERDAVKDLLQQLLPKFKRKANKELEEKNR - UNI24556 - RMLQEDPVLFQLYKDLVVSQVISAEEFWANRLNVNATDSSTSSHKQDVGISAAF

L ADVRPQTDGCNGLRYNLTSDIIESIFRTYPAV VKMKYAETVPHNMTEKEFWTRFFQSHYFHRDRLNTGSKDLFAECAKIDEKG GLKTMVSLGVKNP

MLDLTSLEDKPLDE GYGISSVPSTSNSKSIKENSNAAIIKRFNHHSAMVLAAGLRKQ QQAQNGQNGEPSSVDGNSGDTDCFQPAVKR AKLQESIEYE

DLGNNNSVKTIALNLKKSDR RYYHGPTPIQSLQYATSQDIINSFQSIRQEMEAYTPKLTQ VLSSSAASSTITALSPGGALMQGGTQQAVNQ - UNI1

713 - QMVPNDIQSELKHLYVAVGELLRHFWSCFPVNTPFLEEK - UNI7830 - VVKMKSNLERFQVTKLCPFQEKIRRQYLSTN LVSHIEEMLQ

TAYNKLHAWQSRRLMKKT
Transcript ENSMUST00000107644
Sequence
CAAACTGTTATTAAAACTTGAGCCACGCACCCAGTTCTAGCTATGACCAGTTTGACAGTCATGTAGTGTAAAGTGAACCATCAATACATGGAA GTTTTC

TCTGTATAACAGCCCTGACTGGCCTTGAACTCACAGGGATCGATTGCCTCTGATTCTTGAATG - UNI13524 - CACCTTATAGCCATCATGGCGAC

TTCATCAGAAGAAGTGTTGCTGATTGTGAAGAAGGTTCGTCAGAAGAAGCAGGATGGAGCACTGTACCTCATGGCAGAGAGAATTGCTTGGGCACCTGAA

GGCAAAGACAGATTTACAATCAGCCATATGTATGCAGATATTAAAT GCCAGAAAATCAGTCCAGAGGGAAAAGCTAAAATACAACTTCAGCTGGTCCTG

CATGCAGGGGACACAACAAACTTCCATTTTTCCAACGAAAGCACGGCAGTGAAAGAACGGGATGCAGTGAAGGACCTCCTTCAGCAGCTGCTGCCCAAGT

TCAAGCGGAAAGCTAATAAAGAGCTGGAGGAGAAGAACAG - UNI24556 - AATGCTCCAAGAAGATCCTGTTTTATTCCAACTCTATAAAGACCTT

GTTGTGAGCCAAGTGATCAGTGCTGAGGAATTCTGGGCCAATCGTTTAAATGTGAATGCAACAGATAGTTCTACATCCAGTCACAAGCAGGATGTTGGTA

TTTCTGCAGCATTTCTG GCTGATGTCCGGCCCCAAACGGATGGCTGTAATGGTCTGAGATATAATTTAACTTCTGATATCATTGAATCTATATTTAGGA

CCTATCCAGCAG TAAAAATGAAATATGCAGAAACTGTACCACACAACATGACAGAAAAGGAGTTCTGGACACGCTTTTTCCAGTCCCATTATTTTCACA

GGGACCGACTAAATACAGGATCGAAGGACCTCTTTGCAGAATGTGCCAAAATAGATGAGAAGG GATTAAAAACAATGGTTTCATTAGGAGTGAAAAACC

CAATGCTAGATTTGACATCGTTGGAAGATAAGCCATTAGACGAG GGCTATGGCATTTCCTCTGTGCCATCTACTTCCAATTCCAAATCCATAAAGGAGA

ATAGTAATGCTGCCATCATCAAAAGGTTTAACCACCACAGTGCCATGGTCCTGGCTGCTGGTCTCAGGAAACA ACAAGCACAAAATGGACAGAATGGTG

AGCCCAGCAGCGTGGATGGGAATTCTGGGGATACAGACTGCTTTCAGCCAGCAGTCAAAAGG GCAAAGTTGCAGGAGTCCATTGAATATGAAGACTTGG

GAAACAACAATTCTGTGAAAACGATTGCACTGAATCTCAAGAAGTCAGACAG GTATTACCATGGTCCTACTCCAATTCAGTCACTGCAGTATGCAACAA

GTCAGGACATTATTAACTCTTTTCAAAGTATTAGACAAGAAATGGAAGCTTACACACCCAAGTTAACTCAG GTTCTCTCAAGCAGTGCTGCTAGTAGCA

CCATCACAGCCCTGTCACCTGGAGGAGCTCTTATGCAGGGAGGGACACAGCAAGCCGTAAACC - UNI1713 - AGATGGTGCCAAACGATATTCAGT

CTGAATTGAAACACTTGTATGTGGCTGTTGGGGAACTTCTGCGGCATTTTTGGTCTTGCTTTCCTGTTAATACACCATTCCTAGAAGAAAAG - UNI78

30 - GTAGTGAAAATGAAGAGTAATTTGGAACGGTTCCAAGTTACAAAGCTCTGCCCATTCCAAGAAAAGATTCGGAGGCAGTATTTAAGCACAAAT C

TGGTAAGTCACATAGAAGAGATGCTGCAGACAGCCTACAACAAGCTCCACGCGTGGCAATCCCGGCGCCTGATGAAGAAGACGTGAAGCGTTTATGGTGC

TCACAGGTTTTGTGGGTTGAAAAAAAACTTACCTGCAGTCACTCTGGAAACCTGGCTGAAGACAAGCAGATGCTCACACCGGGGGAAACATCTGCAGCAC

GCCCGCCGACTCCCAGAGCTGATGCTGTTGTACTTGCACATGAAAACTGAAACAGAAGGAAGGGACGGGATTCACCTAACTCTGGGGAGGGAAACCAAGG

CAGAACCAAAATGAGCTAAGTTGCAAATATATATGTATGTGTACATGTATATGTATTTAAAGACTGTTTACTGCAGTTACTCAGGAACTGCTTTTCATTC

ACGTTAAGCTGCTTTCAAAATTTAAGAAAAAAAAATAACTAAAAGAAAAAAA
Translation
 M - UNI13524 - HLIAIMATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKC CQKISPEGKAKIQLQLVLHAGDTTNF

HFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNR - UNI24556 - RMLQEDPVLFQLYKDLVVSQVISAEEFWANRLNVNATDSSTSSHKQD

VGISAAFL ADVRPQTDGCNGLRYNLTSDIIESIFRTYPAV VKMKYAETVPHNMTEKEFWTRFFQSHYFHRDRLNTGSKDLFAECAKIDEKG GLKTMV

SLGVKNPMLDLTSLEDKPLDE GYGISSVPSTSNSKSIKENSNAAIIKRFNHHSAMVLAAGLRKQ QQAQNGQNGEPSSVDGNSGDTDCFQPAVKR AKL

QESIEYEDLGNNNSVKTIALNLKKSDR RYYHGPTPIQSLQYATSQDIINSFQSIRQEMEAYTPKLTQ VLSSSAASSTITALSPGGALMQGGTQQAVNQ

 - UNI1713 - QMVPNDIQSELKHLYVAVGELLRHFWSCFPVNTPFLEEK - UNI7830 - VVKMKSNLERFQVTKLCPFQEKIRRQYLSTN LVS

HIEEMLQTAYNKLHAWQSRRLMKKT

For any suggestions or comments, please send an email to unitrap@crg.es