Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000006673 (Qrich1)
Chromosomal location
Chr 9: 108419445 - 108462491 (+)
Description
glutamine-rich 1 Gene [Source:MGI Symbol;Acc:MGI:1916482]
RefSeq_peptide
NP_780352.2 NP_001107591.1 
UniGene
Mm.335449 
MGI
MGI:1916482 
Uniprot/SWISSPROT
Q3UA37 
Uniprot/SPTREMBL
Q8BMY0 Q8BUN3 Q922W2 Q0VAU4 
Human Ortholog
ENSG00000198218 (QRICH1)
Omim not available
UniTrap UNI1575
Vector Insertion
Chr 9: 108419572 - 108421033
Public Clones CG0793 (sanger) AG0228 (sanger) CC0105 (sanger) RRP184 (baygenomics)
P014E08 (ggtc) G078G01 (ggtc) P151C06 (ggtc) W194D07 (ggtc) PST26087-NR (escells)
Ayu21-T328 (egtc) IST10873C3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1404
Vector Insertion
Chr 9: 108421158 - 108430919
Public Clones CG0109 (sanger) XT0582 (sanger) CF0389 (sanger) CH0788 (sanger)
XT0589 (sanger) D051D04 (ggtc)
Private Clones OST455516 (lexicon) OST300258 (lexicon) OST275170 (lexicon) OST213110 (lexicon)
OST33108 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4175
Vector Insertion
Chr 9: 108431250 - 108435917
Public Clones AM0695 (sanger) RRK171 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21441
Vector Insertion
Chr 9: 108444197 - 108444762
Public Clones not available
Private Clones OST330022 (lexicon)
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI756
Vector Insertion
Chr 9: 108444918 - 108447193
Public Clones CJ0158 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI214
Vector Insertion
Chr 9: 108447332 - 108458292
Public Clones GC0641 (tigem) YHD270 (baygenomics) YHA164 (baygenomics) YHA242 (baygenomics)
YHA252 (baygenomics) IST14786A12 (tigm) IST15053H3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15998
Vector Insertion
Chr 9: 108458402 - 108458738
Public Clones not available
Private Clones OST468399 (lexicon) OST458531 (lexicon) OST39237 (lexicon)
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000006851
Sequence
GGCGCCCAGGGAGCTGTGAGGAGAAAATCCTGTCGGTCTCGGAGCGGCGACGGCAGAACCGAGGCCCCGGGCGGTGAAGCGGGGCCGGCGGGTAGAACGG

AGGCAGCGGCGGCGGTGACGTCGCCGG - UNI1575 - AACAAAGTTAAAACTTAAAAAGAGGCTGAGGATGGAAGGAACTTCTTTGTTCTATCTTCT

TCAGAATGTTAGAAGTCTTAAGAACTCAGGACAAGCAGCAGACATACATGCAACATGGTGACTG - UNI1404 - GAACCCTAAGGACTCTGCAATAT

GAATAATTCTCTAGAGAACACCATCTCATTTGAAGAGTACATCCGAGTAAAGGCGAGGTCTGTCCCGCAACACAGGATGAAGGAATTTCTGGACTCACTG

GCTTCTAAGGGACCAGAAGCTCTTCAGGAGTTCCAGCAGACTGCCACCACCACCATGGTGTACCAGCAGGGTGGGAACTGCATTTATACAGACAGCACTG

AAGTGGCTGGGTCTTTGCTTGAACTTGCTTGTCCAGTCACAACCAGTGTTCAACCACAAACTCAGCAAGAGCAGCAGATCCAGGTTCAGCAGCCACAGCA

GGTTCAG - UNI4175 - GTACAGGTGCAGGTGCAGCAGTCTCCACAACAGGTCTCAGCTCAGCAACTTTCCCCACAGTTCACCGTTCACCAGCCTGC

TGAGCAACCCATCCAGGTCCAGGTGCAGATCCAGGGCCAAGCACCACAGTCCGCAGCCCCCTCCATTCAGACTCCATCTCTGCAGAGCCCCAGCCCCTCA

CAGCTGCAAGCAGCTCAGATCCAGGTGCAGCACGTCCAGGCGGCCCAACAGATCCAGGCTGCAGAAATCCCAGAGGAGCATATCCCACATCAACAAATCC

AGGCTCAGTTGGTAGCTGGCCAATCTCTTGCTGGGGGCCAGCAAATTCAAATTCAGACTGTGGGTGCTCTTTCCCCACCACCATCCCAGCAGGGCTCACC

CAGGGAAGGGGAACGGAGGGTTGGCACAGCCAGTGTCCTTCAGCCAGTGAAGAAACGCAAAGTGGACATGCCTATCACCGTGTCCTACGCCATCTCAGGG

CAGCCAGTGGCCACTGTGCTGGCCATTCCACAAGGCCAGCAACAGAGTTATGTGTCTTTGAGGCCAGACTTACTGACAGTAGACAGTGCCCACCTGTACA

GTGCCACTGGGACCATAACTAGCCCTACAGGAGAAACTTGGACCATCCCTGTTTATTCTGCCCAGCCCCGCGGGGATCCTCAGCAGCAGAGCATTACGCA

CATTGCCATTCCCCAGGAAGCCTACAATGCGGTTCATGTCAGTGGCTCACCTACGGCCCTGGCAGCTGTAAAGCTGGAGGATGACAAGGAGAAGATGGTG

GGCACCACATCTGTAGTGAAAAACTCCCATGAAGAGGTAGTGCAGACCCTTGCAAACTCTCTCTTTCCAGCACAGTTCATGAATGGCAACATCCACATTC

CAGTGGCTGTGCAGGCTGTAGCAGGCACATACCAGAATACGGCTCAGACTGTACATATATGGGACCCACAGCAGCAGCCACAACAGCAAACTGCACAAGA

GCAGACACCACCACCACAACAGCAGCAGCAGCAGCTGCAGGTCACTTGTTCA GCACAGACTGTTCAGGTTGCTGAAGTTGAGCCACAGTCACAACCACA

GCCTTCACCAGAGCTTTTGCTTCCAAATTCTTTGAAGCCAGAAGAAGGGCTTGAAGTATGGAAAAACTGGGCTCAGACCAAGAATGCTGAACTAGAAAAG

GATGCTCAAAACAGATTGGCCCCCATTGGGA - UNI21441 - GGCGACAGTTGCTACGATTTCAGGAAGATCTGATCTCCTCTGCTGTGGCTGAATT

GAATTATGGCCTTTGTTTAATGACACGAGAAGCTCGGAATGGAGAAGGTGAACCCTATGACCCAGATGTACTCTACTACATTTTCCTGTGTATACAGAAG

 - UNI756 - TATCTTTTTGAAAATGGAAGAGTAGATGACATATTTTCTGATCTTTACTATGTTCGTTTCACCGAATGGCTACATGAAGTTCTGAAGG

ATGTACAGCCTCGGGTCACTCCACTTG - UNI214 - GCTATGTGTTGCCCAGTCACGTGACTGAAGAGATGCTGTGGGAATGTAAGCAGCTTGGGGC

ACATTCCCCTTCCACACTGCTGACCACCCTCATGTTCTTTAACACCAA - UNI15998 - GTACTTCCTGTTGAAGACTGTAGATCAGCACATGAAGC

TGGCTTTCTCTAAGGTCCTCCGACAGACAAAGAAGAGCCCCTCGAATCCTAAGGATAAAAGCACGAGCATCCGCTACCTGAAGGCCCTCGGAATACACCA

GACTGGCCAGAAAG TTACAGATGACATGTATGCAGAGCAAACAGAGAATCCAGAGAATCCACTAAGGTGTCCCATCAAGCTCTACGATTTCTACCTCTT

TAAATG CCCTCAGAGTGTGAAAGGCCGAAATGACACCTTTTACCTGACACCTGAGCCAGTTGTAGCTCCCAACAGCCCAATCTGGTACTCAGTCCAGCC

TATCAGCAGAGAACAGATGGGACAGATGCTGACCCGGATCCTGGTTATACGAGAAATCCAAGAAGCCATTGCCGTGGCCAATGCAACCACCATGCACTGA

GGTGCCTCAGCTATAGGAAAAAAGATCCAGGAAAAACCAGACAGACTTTCACACTAAAGGAGAGGCCTCCACATTTTTTTTTAATTTGTAGTTATGATGC

TTTTCAGGCTACTTCTGTTCAAAATGTAAAAGACGATATTGCCCTCTTTGCATCTTCATAAAATGGGCAGACCCCTGGTTCATAGGGATCTGGGTTTTCT

GAGAACCTGGTGTCCTAGGAAGTGGTTGGCTTTTTCTTTTCTCTTTTTTTCTTTTGTCTGGGGCGTGGGGAAAGGAACTTGGACTGTATGGAGAGATACA

GACCCTTCCCTTCCTCAGGGAAGATGGAGCTGCTGATGCATCAGCCTGTCACTCGGAATCGGCAAACTTTACTGACCACTCAGAGCCACATTTGTTTTTT

GTTTTTTGTTTTTTTTTTTTGTAATGCTCAGACATAAACTTAACATCTTGATGGAAGAAGAATAAGGGGAACTTCAATTATGATTTTTATCCAGACAATT

TCTATTACACCCTTCTTTATGACAAGTGACATAAAAGTTAAAGTAAAAACTTTACCATGCGCTTTTTTTTTTTTTTGGCCTAACATTGAGGCCTTAAAAA

TGAGGCTCCTGTGCCTGATGGAATTCTTGTAACATACACTTGTGTATCATATAAAGATACCACTCTTTCTCTTATGTATTCTTATTCTAGTTGTTTATTA

AGAATGACAAGCACGTCTTTTC
Translation
 - UNI1575 -  - UNI1404 - MNNSLENTISFEEYIRVKARSVPQHRMKEFLDSLASKGPEALQEFQQTATTTMVYQQGGNCIYTDSTEVAGSLL

ELACPVTTSVQPQTQQEQQIQVQQPQQVQ - UNI4175 - VQVQVQQSPQQVSAQQLSPQFTVHQPAEQPIQVQVQIQGQAPQSAAPSIQTPSLQSPS

PSQLQAAQIQVQHVQAAQQIQAAEIPEEHIPHQQIQAQLVAGQSLAGGQQIQIQTVGALSPPPSQQGSPREGERRVGTASVLQPVKKRKVDMPITVSYAI

SGQPVATVLAIPQGQQQSYVSLRPDLLTVDSAHLYSATGTITSPTGETWTIPVYSAQPRGDPQQQSITHIAIPQEAYNAVHVSGSPTALAAVKLEDDKEK

MVGTTSVVKNSHEEVVQTLANSLFPAQFMNGNIHIPVAVQAVAGTYQNTAQTVHIWDPQQQPQQQTAQEQTPPPQQQQQQLQVTCS AQTVQVAEVEPQS

QPQPSPELLLPNSLKPEEGLEVWKNWAQTKNAELEKDAQNRLAPIGR - UNI21441 - RRQLLRFQEDLISSAVAELNYGLCLMTREARNGEGEPYD

PDVLYYIFLCIQK - UNI756 - YLFENGRVDDIFSDLYYVRFTEWLHEVLKDVQPRVTPLG - UNI214 - GYVLPSHVTEEMLWECKQLGAHSP

STLLTTLMFFNTK - UNI15998 - KYFLLKTVDQHMKLAFSKVLRQTKKSPSNPKDKSTSIRYLKALGIHQTGQKV VTDDMYAEQTENPENPLRCP

IKLYDFYLFKC CPQSVKGRNDTFYLTPEPVVAPNSPIWYSVQPISREQMGQMLTRILVIREIQEAIAVANATTMH
Transcript ENSMUST00000112155
Sequence
GGCGCCCAGGGAGCTGTGAGGAGAAAATCCTGTCGGTCTCGGAGCGGCGACGGCAGAACCGAGGCCCCGGGCGGTGAAGCGGGGCCGGCGGGTAGAACGG

AGGCAGCGGCGGCGGTGACGTCGCCGG - UNI1575 - AACAAAGTTAAAACTTAAAAAGAGGCTGAGGATGGAAGGAACTTCTTTGTTCTATCTTCT

TCAGAATGTTAGAAGTCTTAAGAACTCAGGACAAGCAGCAGACATACATGCAACATGGTGACTG - UNI1404 - GAACCCTAAGGACTCTGCAATAT

GAATAATTCTCTAGAGAACACCATCTCATTTGAAGAGTACATCCGAGTAAAGGCGAGGTCTGTCCCGCAACACAGGATGAAGGAATTTCTGGACTCACTG

GCTTCTAAGGGACCAGAAGCTCTTCAGGAGTTCCAGCAGACTGCCACCACCACCATGGTGTACCAGCAGGGTGGGAACTGCATTTATACAGACAGCACTG

AAGTGGCTGGGTCTTTGCTTGAACTTGCTTGTCCAGTCACAACCAGTGTTCAACCACAAACTCAGCAAGAGCAGCAGATCCAGGTTCAGCAGCCACAGCA

GGTTCAG - UNI4175 - GCACAGACTGTTCAGGTTGCTGAAGTTGAGCCACAGTCACAACCACAGCCTTCACCAGAGCTTTTGCTTCCAAATTCTTT

GAAGCCAGAAGAAGGGCTTGAAGTATGGAAAAACTGGGCTCAGACCAAGAATGCTGAACTAGAAAAGGATGCTCAAAACAGATTGGCCCCCATTGGGA -

 UNI21441 - GGCGACAGTTGCTACGATTTCAGGAAGATCTGATCTCCTCTGCTGTGGCTGAATTGAATTATGGCCTTTGTTTAATGACACGAGAAGC

TCGGAATGGAGAAGGTGAACCCTATGACCCAGATGTACTCTACTACATTTTCCTGTGTATACAGAAG - UNI756 - TATCTTTTTGAAAATGGAAGA

GTAGATGACATATTTTCTGATCTTTACTATGTTCGTTTCACCGAATGGCTACATGAAGTTCTGAAGGATGTACAGCCTCGGGTCACTCCACTTGGTAAGA

GTTTACCTAGTCTTTGA
Translation
 - UNI1575 -  - UNI1404 - MNNSLENTISFEEYIRVKARSVPQHRMKEFLDSLASKGPEALQEFQQTATTTMVYQQGGNCIYTDSTEVAGSLL

ELACPVTTSVQPQTQQEQQIQVQQPQQVQ - UNI4175 - AQTVQVAEVEPQSQPQPSPELLLPNSLKPEEGLEVWKNWAQTKNAELEKDAQNRLAPI

GR - UNI21441 - RRQLLRFQEDLISSAVAELNYGLCLMTREARNGEGEPYDPDVLYYIFLCIQK - UNI756 - YLFENGRVDDIFSDLYYVRF

TEWLHEVLKDVQPRVTPLGKSLPSL

For any suggestions or comments, please send an email to unitrap@crg.es