Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000006675 (4933406E20Rik)
Chromosomal location
Chr 9: 108481157 - 108499931 (-)
Description
RIKEN cDNA 4933406E20 gene Gene [Source:MGI Symbol;Acc:MGI:1921693]
RefSeq_dna
NM_028944 
RefSeq_peptide
NP_083220.3 
UniGene
Mm.405400 
MGI
MGI:1921693 
Uniprot/SWISSPROT
Q8BG58 
Uniprot/SPTREMBL
Q2M2M8 
Human Ortholog
ENSG00000178467 (PH-4)
Omim not available
UniTrap UNI32733
Vector Insertion
Chr 9: 108499229 - 108499932
Public Clones IST14975H4 (tigm) IST11093F8 (tigm) IST10407H1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14557
Vector Insertion
Chr 9: 108485972 - 108499312
Public Clones FHCRC-GT-S6-2E1 (fhcrc) IST11931F7 (tigm) IST10407H1 (tigm) IST12739C12 (tigm)
IST12743B2 (tigm) IST15051G10 (tigm) IST13244H7 (tigm) IST10453E1 (tigm)
IST13004E6 (tigm) IST10314A3 (tigm) IST11380F12 (tigm) IST12447D7 (tigm)
IST10174E4 (tigm) IST12354D11 (tigm) IST10807B10 (tigm) IST10649D8 (tigm)
IST12865D1 (tigm) IST11522A8 (tigm)
Private Clones OST442489 (lexicon) OST440578 (lexicon) OST429869 (lexicon) OST425260 (lexicon)
OST402305 (lexicon) OST390795 (lexicon) OST379611 (lexicon) OST367836 (lexicon)
OST360970 (lexicon) OST354834 (lexicon) OST308276 (lexicon) OST300962 (lexicon)
OST279817 (lexicon) OST220766 (lexicon) OST176552 (lexicon) OST176516 (lexicon)
OST162497 (lexicon) OST149468 (lexicon) OST134794 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27752
Vector Insertion
Chr 9: 108485275 - 108485972
Public Clones not available
Private Clones OST50477 (lexicon)
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22770
Vector Insertion
Chr 9: 108484336 - 108485177
Public Clones IST14191A9 (tigm)
Private Clones OST285241 (lexicon)
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18419
Vector Insertion
Chr 9: 108483236 - 108484172
Public Clones not available
Private Clones OST423736 (lexicon) OST337889 (lexicon) OST314028 (lexicon)
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15815
Vector Insertion
Chr 9: 108482438 - 108483049
Public Clones IST10361D5 (tigm)
Private Clones OST472596 (lexicon)
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13266
Vector Insertion
Chr 9: 108482171 - 108482346
Public Clones CMHD-GT_341B4-3 (cmhd)
Private Clones OST21595 (lexicon) OST13149 (lexicon)
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26390
Vector Insertion
Chr 9: 108481640 - 108482046
Public Clones IST14975F8 (tigm) IST14578B11 (tigm) IST12670H6 (tigm) IST13787A1 (tigm)
Private Clones OST121480 (lexicon) OST121472 (lexicon) OST121398 (lexicon) OST121387 (lexicon)
OST23258 (lexicon)
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000006853
Sequence
GGCCCCTCCCCTGGGCGCGCGCGCGACCTGGGCGCCATGGCGGCAGCGGTGGCGACCGTGCAGCGGCCTGAGGCTGAGACAGTCGAGGAGGCCTCAAATC

TTCAGTGGCCGCTACCACCGGAGCATCGCCCTTCCGGGGCAGCGACCAGACCAGGCGATAGTGAAGACGCCCCGGTGCGGCCACTGTGCAAGCCGCGGGG

CATCTGTTCCCGTGCCTACTTCTTGGTGCTGATGGTGTTCGTGCACCTGTACTTGGGCAACGTGCTGGCCCTGCTGCTCTTCGTGCACTACAGCAACGGA

GACGAGAGCACAGACCCCGGACCCCAGCGCCGCGAGCAGAGCCCCCAGCCAGTGCCAACCTTGGGTCCCCTCACCCGGCTGGAGGGCATCAAG - UNI1

4557 - - UNI32733 - GTGGGATATGAGCGGAAAGTCCAGGTGGTCGCGGGCAGGGATCACTTCATCCGAACCCTCAGCCTCAAGCCGCTGCTTTT

TG - UNI14557 - - UNI32733 - AAATCCCAGGCTTCCTGAGTGACGAGGAGTGTCGGCTCATCATCCACCTGGCACAGATGAAAGGGTTACAG

CGAAGCCAGATCCTGCCCACTGAGGAGTATGAGGAGGCGATGAGCGCCATGCAGGTCAGCCAGCTGGACCTCTTCCAGCTGTTGGATCAGAACCACGACG

GTCGCCTGCAGCTCCGAGAG - UNI14557 - - UNI27752 - GTCCTGGCCCAGACTCGCCTGGGAAATGGACGGTGGATGACTCCAGAGAACAT

TCAGGAGATGTACTCTGCAATCAAAGCAGACCCTGACGGTGATG - UNI22770 - GCGTGCTGAGTCTGCAGGAATTTTCCAACATGGACCTCCGAG

ACTTCCACAAGTACATGAGGAGCCATAAGGCAGAATCCAATGAGCTGGTGAGGAACAGCCACCACACATGGCTCCACCAGGGAGAGGGAGCACATCACGT

CATGCGTGCCATCCGCCAGAG - UNI18419 - GGTCCTGCGCCTCACTCGCCTCTCCCCGGAGATTGTGGAGTTCAGTGAGCCACTACAGGTTGTAC

GATATGGTGAGGGAGGTCACTACCATGCCCATGTGGACAGCGGACCCGTGTACCCAGAGACCATCTGCTCCCATACCAAGCTGGTAGCCAATGAATCTGT

ACCGTTTGAGACCTCCTGTCG - UNI15815 - CTACATGACAGTGCTGTTTTATTTGAACAATGTCACCGGTGGGGGTGAGACCGTCTTCCCTGTGG

CAGACAACAGGACCTATGATGAAATG - UNI13266 - AGTCTGATTCAGGATGATGTCGATCTCCGGGACACTCGAAGGCACTGTGACAAGGGCAAC

CTTCGTGTCAAGCCCCAGCAAGGAACTGCAGTCTTTTGGTACAACTACCTTCCTGATGGGCAAG - UNI26390 - GCTGGGTGGGTGAAGTGGACGA

CTACTCGTTGCATGGGGGCTGCCTGGTCACCCGCGGCACCAAGTGGATCGCTAACAACTGGATCAATGTGGACCCTAGCCGGGCACGGCAAGCCTTGTTC

CAGCAGGAGATGGCTCGTCTGGCTCGGGAAGGTGGCATGGACTCACAACCCGAGTGGGCCTTGGACCGAGCCTACAGTGATGCCCGTGTGGAGCTCTGAC

GCAAGGCCCTGATGCGAATCACCCGCTGCCCAACGTCAAAGACCCTGCAGGTCCTCTGTCCTACTGCAGACTGAAGTTCTGGCCGACCTCTTGCCCTAGC

CCTCCCTGCCTGCAGCCGCGATCAAAGGCGCAGTTCCTACATTCACGTTATTTATTGGTGTACAGCCTCCATGCTGCTCCGTTAAATAAAACTACAGGGC

TTCCAGCCAGGGGCCGGCGAGCTAAGCGCCCGCTTGGGGGAGGGGAGGCCCACCGCCCCTC
Translation
MAAAVATVQRPEAETVEEASNLQWPLPPEHRPSGAATRPGDSEDAPVRPLCKPRGICSRAYFLVLMVFVHLYLGNVLALLLFVHYSNGDESTDPGPQRRE

QSPQPVPTLGPLTRLEGIK - UNI14557 - - UNI32733 - VGYERKVQVVAGRDHFIRTLSLKPLLFE - UNI14557 - - UNI32733 -

 EIPGFLSDEECRLIIHLAQMKGLQRSQILPTEEYEEAMSAMQVSQLDLFQLLDQNHDGRLQLRE - UNI14557 - - UNI27752 - VLAQTRLG

NGRWMTPENIQEMYSAIKADPDGDG - UNI22770 - GVLSLQEFSNMDLRDFHKYMRSHKAESNELVRNSHHTWLHQGEGAHHVMRAIRQR - UNI

18419 - RVLRLTRLSPEIVEFSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCR - UNI15815 - RYMTVLFYLNNVTGG

GETVFPVADNRTYDEM - UNI13266 - SLIQDDVDLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQG - UNI26390 - GWVGEVDDYSLHGG

CLVTRGTKWIANNWINVDPSRARQALFQQEMARLAREGGMDSQPEWALDRAYSDARVEL

For any suggestions or comments, please send an email to unitrap@crg.es