Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000006676 (Usp19)
Chromosomal location
Chr 9: 108393079 - 108404287 (+)
Description
ubiquitin specific peptidase 19 Gene [Source:MGI Symbol;Acc:MGI:1918722]
RefSeq_dna
NM_027804 
RefSeq_peptide
NP_082080.2 
UniGene
Mm.289706 
MGI
MGI:1918722 
Uniprot/SWISSPROT
Q3UJD6 
Human Ortholog
ENSG00000172046 (USP19)
Omim not available
UniTrap UNI25890
Vector Insertion
Chr 9: 108393227 - 108394801
Public Clones CMHD-GT_534G5-3 (cmhd) IST14403G5 (tigm)
Private Clones OST154276 (lexicon) OST147661 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9732
Vector Insertion
Chr 9: 108395062 - 108395298
Public Clones XG128 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2289
Vector Insertion
Chr 9: 108402601 - 108403524
Public Clones AG0414 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000085044
Sequence
GCGGCTGAAGCAGCGGCGAAGGCGGCGGTGGCGGAGGAGCCGGGACGGGGGAGGGGCGCGCCGGAACCGGAACCGACCCGACGCCGGAACCGGAATCGAG

AGCGTGTTGCCAGGGCCCGAAGAGGGCTGGTGGCGGCGGTCTCGCTCG - UNI25890 - GCTCTTGGTTCTTTGCTGAAGAATTTGGCCACAAAGAG

TTGCCAAGATAGCTGGGCCGGGAAGAAAGCGCCGCAGCCCTGACCCAGACGCTGTTGCCGACTCTGGGCCACTCTGGCTGGCTACCAAGCGGCTCAAGAT

GTCTGCAGGGGCCAGTGCTACAGGGCCCAGGAGGGGGCCGCCAGGACTGGAAGAGGCCACTAGTAAGAAGAAACAGAAGGATCGAGCAAACCTGGAAAGT

AAAGATGGAGATGCTAGGAGAG - UNI9732 - TGTCCCTTCCTCGAAAGGAACCAACCAAAGATG AATTGTTGCTCGATTGGAGGCAGAGTGCAGA

TGAGGTGATTGTTAAGCTGCGCGTGGGAACAGGTCCCGTACGTCTGGAGGATGTAGATGCTGCGTTCACAGACACGGACTGTGTGGTGAGGCTTCCAG A

TGGTCGGCAGTGGGGTGGTGTCTTCTTTGCTGAAATACAAAGTTCTTGCACCAAAGTGCAGGCTCGCAAGGGTGGTCTTCTACAGCTAGTACTACCCAAG

AAGGTGCCTCTGCTCACGTGGCCCTCTCTCCTG AAACCTCTGGGAACCCAAGAGCTGGTGCCAGGTTTGCAGTGCCAGGAGAACGGGCAAGAGCTGTCT

CCCATTGCCCTGGAGCCAGGCTCTGAGCCCCGCAGAGCTAAACAGGAAGCCCGAAACCAGAAGCGGGCCCAGGGCCGTGGTGAGGTAGGCTCGGGGGCTG

GCCCTGGGACACAGGCAGGGCCCAGCGCCAAGAGGGCTGTTCACCTCCGCAGAGGGCCAGAAGGGGAAGGGTCCATGGATGGCCCCGGCCCCCAGGGTGA

TGCCCCGTCTTTCCTGTCTGACTCAGCTACCCAG GTTGAGGCTGAGGAGAAGCTCTGTGCTCCACCAATGAACACTCAAACAAGTCTCTTGAGCTCAGA

GAAGAGTTTAGCCCTTCTGACAGTAGAGAAGACAGTGTCCCCCAGGAATGACCCAGTCGCCCCGGTTATGGTCCAGGACAGAGACCCTGAGCCTGAGCAA

GAAGACCAAGTCAAAGAGGAGATGGCACTTGGGGCTGATCCTACAGCCTTGGTGGAGG AACCAGAGTCTATGGTGAACCTGGCATTTGTCAAGAACGAC

TCGTATGAGAAGGGCCCGGATTCGGTGGTGGTGCACGTGTACGTGAAGGAGATCCGCAGGGACAGCTCCCGAGTGCTCTTCCGAGAGCAGGACTTCACAC

TGATCTTCCAGACCAG GGACGGAAACTTTCTGAGGCTGCATCCGGGCTGTGGGCCCCACACCATCTTCCGATGGCAGGTGAAGCTCAG AAACTTGATT

GAACCAGAGCAGTGTACGTTCTGTTTCACGGCCTCTCGAATCGATATCTGCCTCCGGAAGCGGCAGAGTCAGCGCTGGGGGGGACTGGAGGCCCCTGCTA

CACGAG GTGCAGTGGGTGGTGCAAAGGTTGCCGTGCCGACAGGCCCAACCCCTTTGGATTCAACCCCTCCAGGAGGTGGCCCCCACCCCCTGACAGGCC

AGGAGGAAGCCAGGGCTGTGGAGAAGGAAAAACCCAAGGCTCGATCAGAGGACTCAGGGCTGGATGGTGTGGTGGCCCGCACCCCCTTGGAGCATGTAGC

CCCAAAGCCAGACCCACACTTGGCCTCG CCCAAACCCACGTGTATGGTGCCTCCAATGCCGCACAGTCCAGTTAGTGGGGATAGTGTGGAGGAGGACGA

AGAGGAAGAGAAGAAGGTGTGCCTGCCAGGCTTCACTGGCCTTGTCAACTTAGGGAACACCTGCTTCATGAATAGCGTCATTCAGTCTTTGTCCAACACT

CGGGAACTTCGTGACTTCTTTCACG ACCGATCCTTTGAAGCTGAGATTAACTACAATAACCCATTGGGGACTGGTGGGCGCCTCGCCATTGGCTTTGCT

GTGCTGCTCCGGGCCCTATGGAAGGGTACTCACCAAGCCTTTCAGCCCTCCAAGCTAAAG GCCATTGTGGCAAGCAAGGCCAGCCAGTTCACAGGCTAT

GCACAGCATGATGCTCAAGAGTTCATGGCTTTCTTGTTGGATGGGCTACATGAAGACCTCAATCGAATCCAAAACAAACCCTACACAGAGACTGTGGACT

CGGACGGGCGGCCCGATGAG GTGGTAGCCGAGGAAGCATGGCAGCGGCACAAGATGAGAAATGATTCATTCATTGTGGACCTGTTTCAGGGCCAGTACA

AGTCAAAGCTGGTGTGCCCTGTGTGTGCCAAG GTCTCCATCACTTTTGACCCGTTCCTTTATCTGCCGGTACCCTTGCCACAAAAGCAAAAGGTTCTCC

CCATATTTTATTTTGCCAGGGAGCCCCACAGCAAGCCCATCAAG TTCCTGGTGAGTGTCAGCAAGGAGAACTCCAGCGCGAGTGAAGTGTTGGACTCCC

TCTCTCAGAGTGTCCACGTGAAGCCTGAGAACCTGCGCCTAGCCGAG GTAATTAAGAACCGTTTCCACCGTGTTTTCTTGCCCTCCCACTCACTGGACG

CTGTGTCCCCCACGGACGTGCTCCTCTGCTTTGAGCTGCTCTCCCCAGAACTGGCTAAGGAGCGGGTAGTAGTGCTGGAGGTGCAGCAG CGCCCCCAGG

TACCCAGCATCCCTATCTCCAAGTGCGCAGCCTGCCAGCGGAAGCAGCAATCAGAAGAAGAAAAGCTGAAGCGCTGTACCCGTTGCTACCGTGTGGGCTA

CTGCAACCA GTTCTGCCAGAAAACCCATTGGCCTGACCACAAAGGCCTCTGCCGCCCTGAGAACATTGGCTACCCCTTCCTGGTCAGTGTGCCTGCTTC

ACGCCTCACTTATGCCCGTCTTGCTCAGCTACTAGAAGGTTATGCCCG GTACTCTGTGAGTGTATTCCAACCGCCCTTCCAGCCTGGCCGCATGGCTTT

GGAATCGCAGAGCCCTGGCTGTACCACGTTGCTTTCAACCAGCTCTCTGGAGGCTGGGGACAGTGAAAGAGAACCCATTCAGCCTTCTGAGCTCCAGCTG

GTGACCCCTGTGGCTGAAGGGGATACAGGGGCTCACCGAGTATGGCCGCCTGCTGATAGGGGTCCTGTGCCTAGCACCAGTGGACTCTCTTCTGAGATGC

TGGCCAGTGGGCCTATCGAAGGTTGTCCCTTGCTTGCTGGTGAGAGGGTATCTCGGCCTGAAG CTGCTGTGCCTGGGTACCAACACTCAAGTGAATCTG

TGAATACCCACACGCCCCAGTTCTTCATCTATAAAATTGATGCATCAAACCGTGAGCAGCGGCTGGAGGACAAAG GGGAGACACCATTGGAGCTAGGTG

ATGACTGTAGCCTGGCTCTGGTGTGGCGGAACAATGAACGCCTGCAGGAGTTTGTGTTGGTAGCCTCCAAGGAGCTGGAATGTGCTGAAGATCCAGGCTC

TGCTGGTGAGGCTGCCCGTGCTGGCCACTTCACCCTGGACCAGTGCCTCAACCTCTTTACACGGCCTGAAGTGCTGGCACCTGAGGAGGCCTG GTACTG

CCCACAGTGCAAACAGCATCGTGAGGCCTCCAAACAGCTGCTGTTGTGGCGCCTACCGAACGTGCTGATTGTGCAGCTCAAGCGCTTCTCCTTTCGTAGT

TTCATTTGGCGAGACAAGATCAATGACTTGGTGGAGTTTCCTGTTCG GAACCTGGACTTGAGCAAGTTCTGTATCGGTCAGAAAGAGGAGCAGCTGCCT

AGCTATGACCTGTATGCTGTCATCAACCACTACGGAGGCATGATCGGTGGCCACTATACTGCTTGTGCACGGCTGCCCAATGATCGCAGTAGCCAGCGCA

GTGACGTGG GCTGGCGCTTGTTTGATGACAGCACGGTGACAACAGTAGACGAAAGCCAGGTCGTGACGCGCTATGCCTATGTTCTCTTCTACCGTCGTC

GGAACTCTCCTGTGGAGAGACCCCCCAGGGCAAGTCACTCTGAACACCACCCAGACCTAGGCCCTGCAGCTGAGGCTGCTGCCAGCCAG - UNI2289 

- GGACTAGGCCCTGGCCAGGCCCCCGAGGTGGCCCCCACGCGGACAGCCCCTGAACGCTTCGCCCCCCCTGTGGACCGCCCAGCCCCCACGTACAGCAA

CATGGAGGAGGTCGATTAG
Translation
 - UNI25890 - RIWPQRVAKIAGPGRKRRSPDPDAVADSGPLWLATKRLKMSAGASATGPRRGPPGLEEATSKKKQKDRANLESKDGDARRV - UN

I9732 - VSLPRKEPTKDE ELLLDWRQSADEVIVKLRVGTGPVRLEDVDAAFTDTDCVVRLPD DGRQWGGVFFAEIQSSCTKVQARKGGLLQLVLPK

KVPLLTWPSLL KPLGTQELVPGLQCQENGQELSPIALEPGSEPRRAKQEARNQKRAQGRGEVGSGAGPGTQAGPSAKRAVHLRRGPEGEGSMDGPGPQG

DAPSFLSDSATQ VEAEEKLCAPPMNTQTSLLSSEKSLALLTVEKTVSPRNDPVAPVMVQDRDPEPEQEDQVKEEMALGADPTALVEE EPESMVNLAFV

KNDSYEKGPDSVVVHVYVKEIRRDSSRVLFREQDFTLIFQTR RDGNFLRLHPGCGPHTIFRWQVKLR RNLIEPEQCTFCFTASRIDICLRKRQSQRWG

GLEAPATRG GAVGGAKVAVPTGPTPLDSTPPGGGPHPLTGQEEARAVEKEKPKARSEDSGLDGVVARTPLEHVAPKPDPHLAS PKPTCMVPPMPHSPV

SGDSVEEDEEEEKKVCLPGFTGLVNLGNTCFMNSVIQSLSNTRELRDFFHD DRSFEAEINYNNPLGTGGRLAIGFAVLLRALWKGTHQAFQPSKLK AI

VASKASQFTGYAQHDAQEFMAFLLDGLHEDLNRIQNKPYTETVDSDGRPDE VVAEEAWQRHKMRNDSFIVDLFQGQYKSKLVCPVCAK VSITFDPFLY

LPVPLPQKQKVLPIFYFAREPHSKPIK FLVSVSKENSSASEVLDSLSQSVHVKPENLRLAE VIKNRFHRVFLPSHSLDAVSPTDVLLCFELLSPELAK

ERVVVLEVQQ RPQVPSIPISKCAACQRKQQSEEEKLKRCTRCYRVGYCNQ QFCQKTHWPDHKGLCRPENIGYPFLVSVPASRLTYARLAQLLEGYAR 

RYSVSVFQPPFQPGRMALESQSPGCTTLLSTSSLEAGDSEREPIQPSELQLVTPVAEGDTGAHRVWPPADRGPVPSTSGLSSEMLASGPIEGCPLLAGER

VSRPEA AAVPGYQHSSESVNTHTPQFFIYKIDASNREQRLEDKG GETPLELGDDCSLALVWRNNERLQEFVLVASKELECAEDPGSAGEAARAGHFTL

DQCLNLFTRPEVLAPEEAW WYCPQCKQHREASKQLLLWRLPNVLIVQLKRFSFRSFIWRDKINDLVEFPVR RNLDLSKFCIGQKEEQLPSYDLYAVIN

HYGGMIGGHYTACARLPNDRSSQRSDVG GWRLFDDSTVTTVDESQVVTRYAYVLFYRRRNSPVERPPRASHSEHHPDLGPAAEAAASQ - UNI2289 

- GLGPGQAPEVAPTRTAPERFAPPVDRPAPTYSNMEEVD
Transcript ENSMUST00000006854
Sequence
GCGGCTGAAGCAGCGGCGAAGGCGGCGGTGGCGGAGGAGCCGGGACGGGGGAGGGGCGCGCCGGAACCGGAACCGACCCGACGCCGGAACCGGAATCGAG

AGCGTGTTGCCAGGGCCCGAAGAGGGCTGGTGGCGGCGGTCTCGCTCG - UNI25890 - GCTCTTGGTTCTTTGCTGAAGAATTTGGCCACAAAGAG

TTGCCAAGATAGCTGGGCCGGGAAGAAAGCGCCGCAGCCCTGACCCAGACGCTGTTGCCGACTCTGGGCCACTCTGGCTGGCTACCAAGCGGCTCAAGAT

GTCTGCAGGGGCCAGTGCTACAGGGCCCAGGAGGGGGCCGCCAGGACTGGAAGAGGCCACTAGTAAGAAGAAACAGAAGGATCGAGCAAACCTGGAAAGT

AAAGATGGAGATGCTAGGAGAG - UNI9732 - TGTCCCTTCCTCGAAAGGAACCAACCAAAGATG AATTGTTGCTCGATTGGAGGCAGAGTGCAGA

TGAGGTGATTGTTAAGCTGCGCGTGGGAACAGGTCCCGTACGTCTGGAGGATGTAGATGCTGCGTTCACAGACACGGACTGTGTGGTGAGGCTTCCAG A

TGGTCGGCAGTGGGGTGGTGTCTTCTTTGCTGAAATACAAAGTTCTTGCACCAAAGTGCAGGCTCGCAAGGGTGGTCTTCTACAGCTAGTACTACCCAAG

AAGGTGCCTCTGCTCACGTGGCCCTCTCTCCTG AAACCTCTGGGAACCCAAGAGCTGGTGCCAGGTTTGCAGTGCCAGGAGAACGGGCAAGAGCTGTCT

CCCATTGCCCTGGAGCCAGGCTCTGAGCCCCGCAGAGCTAAACAGGAAGCCCGAAACCAGAAGCGGGCCCAGGGCCGTGGTGAGGTAGGCTCGGGGGCTG

GCCCTGGGACACAGGCAGGGCCCAGCGCCAAGAGGGCTGTTCACCTCCGCAGAGGGCCAGAAGGGGAAGGGTCCATGGATGGCCCCGGCCCCCAGGGTGA

TGCCCCGTCTTTCCTGTCTGACTCAGCTACCCAG GTTGAGGCTGAGGAGAAGCTCTGTGCTCCACCAATGAACACTCAAACAAGTCTCTTGAGCTCAGA

GAAGAGTTTAGCCCTTCTGACAGTAGAGAAGACAGTGTCCCCCAGGAATGACCCAGTCGCCCCGGTTATGGTCCAGGACAGAGACCCTGAGCCTGAGCAA

GAAGACCAAGTCAAAGAGGAGATGGCACTTGGGGCTGATCCTACAGCCTTGGTGGAGG AACCAGAGTCTATGGTGAACCTGGCATTTGTCAAGAACGAC

TCGTATGAGAAGGGCCCGGATTCGGTGGTGGTGCACGTGTACGTGAAGGAGATCCGCAGGGACAGCTCCCGAGTGCTCTTCCGAGAGCAGGACTTCACAC

TGATCTTCCAGACCAG GGACGGAAACTTTCTGAGGCTGCATCCGGGCTGTGGGCCCCACACCATCTTCCGATGGCAGGTGAAGCTCAG AAACTTGATT

GAACCAGAGCAGTGTACGTTCTGTTTCACGGCCTCTCGAATCGATATCTGCCTCCGGAAGCGGCAGAGTCAGCGCTGGGGGGGACTGGAGGCCCCTGCTA

CACGAG GTGCAGTGGGTGGTGCAAAGGTTGCCGTGCCGACAGGCCCAACCCCTTTGGATTCAACCCCTCCAGGAGGTGGCCCCCACCCCCTGACAGGCC

AGGAGGAAGCCAGGGCTGTGGAGAAGGAAAAACCCAAGGCTCGATCAGAGGACTCAGGGCTGGATGGTGTGGTGGCCCGCACCCCCTTGGAGCATGTAGC

CCCAAAGCCAGACCCACACTTGGCCTCG CCCAAACCCACGTGTATGGTGCCTCCAATGCCGCACAGTCCAGTTAGTGGGGATAGTGTGGAGGAGGACGA

AGAGGAAGAGAAGAAGGTGTGCCTGCCAGGCTTCACTGGCCTTGTCAACTTAGGGAACACCTGCTTCATGAATAGCGTCATTCAGTCTTTGTCCAACACT

CGGGAACTTCGTGACTTCTTTCACG ACCGATCCTTTGAAGCTGAGATTAACTACAATAACCCATTGGGGACTGGTGGGCGCCTCGCCATTGGCTTTGCT

GTGCTGCTCCGGGCCCTATGGAAGGGTACTCACCAAGCCTTTCAGCCCTCCAAGCTAAAG GCCATTGTGGCAAGCAAGGCCAGCCAGTTCACAGGCTAT

GCACAGCATGATGCTCAAGAGTTCATGGCTTTCTTGTTGGATGGGCTACATGAAGACCTCAATCGAATCCAAAACAAACCCTACACAGAGACTGTGGACT

CGGACGGGCGGCCCGATGAG GTGGTAGCCGAGGAAGCATGGCAGCGGCACAAGATGAGAAATGATTCATTCATTGTGGACCTGTTTCAGGGCCAGTACA

AGTCAAAGCTGGTGTGCCCTGTGTGTGCCAAG GTCTCCATCACTTTTGACCCGTTCCTTTATCTGCCGGTACCCTTGCCACAAAAGCAAAAGGTTCTCC

CCATATTTTATTTTGCCAGGGAGCCCCACAGCAAGCCCATCAAG TTCCTGGTGAGTGTCAGCAAGGAGAACTCCAGCGCGAGTGAAGTGTTGGACTCCC

TCTCTCAGAGTGTCCACGTGAAGCCTGAGAACCTGCGCCTAGCCGAG GTAATTAAGAACCGTTTCCACCGTGTTTTCTTGCCCTCCCACTCACTGGACG

CTGTGTCCCCCACGGACGTGCTCCTCTGCTTTGAGCTGCTCTCCCCAGAACTGGCTAAGGAGCGGGTAGTAGTGCTGGAGGTGCAGCAG CGCCCCCAGG

TACCCAGCATCCCTATCTCCAAGTGCGCAGCCTGCCAGCGGAAGCAGCAATCAGAAGAAGAAAAGCTGAAGCGCTGTACCCGTTGCTACCGTGTGGGCTA

CTGCAACCA GTTCTGCCAGAAAACCCATTGGCCTGACCACAAAGGCCTCTGCCGCCCTGAGAACATTGGCTACCCCTTCCTGGTCAGTGTGCCTGCTTC

ACGCCTCACTTATGCCCGTCTTGCTCAGCTACTAGAAGGTTATGCCCG GTACTCTGTGAGTGTATTCCAACCGCCCTTCCAGCCTGGCCGCATGGCTTT

GGAATCGCAGAGCCCTGGCTGTACCACGTTGCTTTCAACCAGCTCTCTGGAGGCTGGGGACAGTGAAAGAGAACCCATTCAGCCTTCTGAGCTCCAGCTG

GTGACCCCTGTGGCTGAAGGGGATACAGGGGCTCACCGAGTATGGCCGCCTGCTGATAGGGGTCCTGTGCCTAGCACCAGTGGACTCTCTTCTGAGATGC

TGGCCAGTGGGCCTATCGAAGGTTGTCCCTTGCTTGCTGGTGAGAGGGTATCTCGGCCTGAAG CTGCTGTGCCTGGGTACCAACACTCAAGTGAATCTG

TGAATACCCACACGCCCCAGTTCTTCATCTATAAAATTGATGCATCAAACCGTGAGCAGCGGCTGGAGGACAAAG GGGAGACACCATTGGAGCTAGGTG

ATGACTGTAGCCTGGCTCTGGTGTGGCGGAACAATGAACGCCTGCAGGAGTTTGTGTTGGTAGCCTCCAAGGAGCTGGAATGTGCTGAAGATCCAGGCTC

TGCTGGTGAGGCTGCCCGTGCTGGCCACTTCACCCTGGACCAGTGCCTCAACCTCTTTACACGGCCTGAAGTGCTGGCACCTGAGGAGGCCTG GTACTG

CCCACAGTGCAAACAGCATCGTGAGGCCTCCAAACAGCTGCTGTTGTGGCGCCTACCGAACGTGCTGATTGTGCAGCTCAAGCGCTTCTCCTTTCGTAGT

TTCATTTGGCGAGACAAGATCAATGACTTGGTGGAGTTTCCTGTTCG GAACCTGGACTTGAGCAAGTTCTGTATCGGTCAGAAAGAGGAGCAGCTGCCT

AGCTATGACCTGTATGCTGTCATCAACCACTACGGAGGCATGATCGGTGGCCACTATACTGCTTGTGCACGGCTGCCCAATGATCGCAGTAGCCAGCGCA

GTGACGTGG GCTGGCGCTTGTTTGATGACAGCACGGTGACAACAGTAGACGAAAGCCAGGTCGTGACGCGCTATGCCTATGTTCTCTTCTACCGTCGTC

GGAACTCTCCTGTGGAGAGACCCCCCAGGGCAAGTCACTCTGAACACCACCCAGACCTAGGCCCTGCAGCTGAGGCTGCTGCCAGCCAG - UNI2289 

- GCTTCCCGGATTTGGCAGGAGCTCGAGGCCGAGGAGGAGATGGTACCTGAGGGGCCTGGGCCTCTGGGTCCTTGGGGGCCCCAAGACTGGGTGGGGCC

CCCGCCACGTGGCCCTACCACACCAGACGAGGGTTGCCTCCGATACTTTGTCCTGGGTACCGTGGCGGCTTTGGTGGCCCTTGTGCTCAACGTATTCTAT

CCTCTGGTATCTCAGAGTCGCTGGAGATGAGCTCACCTGCAGGCACCTGCTGTGAGCTGGCCTACCTGTCTGCTCACCAGGTCATGCCTACCTTTGTGGT

GGGAAACAACTCTGGGCTCTGAGCCTCAGTGTATGTATCTGGTGGGAGACTTGTGGGGACTGCAGTCTCTGCAGGGGCAGAGTATCCTAGGGTGTGTGTC

CATCCAGTTGTCTGTCGTCCTGTTTCTCTGACCCTTGTCCTAGGGCTTGGCCCTGCTGGAACTATTTCCTGTATTTAAAGTGTTAATAAAATGAGTATTC

AGGCCC
Translation
 - UNI25890 - MSAGASATGPRRGPPGLEEATSKKKQKDRANLESKDGDARRV - UNI9732 - VSLPRKEPTKDE ELLLDWRQSADEVIVKLR

VGTGPVRLEDVDAAFTDTDCVVRLPD DGRQWGGVFFAEIQSSCTKVQARKGGLLQLVLPKKVPLLTWPSLL KPLGTQELVPGLQCQENGQELSPIALE

PGSEPRRAKQEARNQKRAQGRGEVGSGAGPGTQAGPSAKRAVHLRRGPEGEGSMDGPGPQGDAPSFLSDSATQ VEAEEKLCAPPMNTQTSLLSSEKSLA

LLTVEKTVSPRNDPVAPVMVQDRDPEPEQEDQVKEEMALGADPTALVEE EPESMVNLAFVKNDSYEKGPDSVVVHVYVKEIRRDSSRVLFREQDFTLIF

QTR RDGNFLRLHPGCGPHTIFRWQVKLR RNLIEPEQCTFCFTASRIDICLRKRQSQRWGGLEAPATRG GAVGGAKVAVPTGPTPLDSTPPGGGPHPL

TGQEEARAVEKEKPKARSEDSGLDGVVARTPLEHVAPKPDPHLAS PKPTCMVPPMPHSPVSGDSVEEDEEEEKKVCLPGFTGLVNLGNTCFMNSVIQSL

SNTRELRDFFHD DRSFEAEINYNNPLGTGGRLAIGFAVLLRALWKGTHQAFQPSKLK AIVASKASQFTGYAQHDAQEFMAFLLDGLHEDLNRIQNKPY

TETVDSDGRPDE VVAEEAWQRHKMRNDSFIVDLFQGQYKSKLVCPVCAK VSITFDPFLYLPVPLPQKQKVLPIFYFAREPHSKPIK FLVSVSKENSS

ASEVLDSLSQSVHVKPENLRLAE VIKNRFHRVFLPSHSLDAVSPTDVLLCFELLSPELAKERVVVLEVQQ RPQVPSIPISKCAACQRKQQSEEEKLKR

CTRCYRVGYCNQ QFCQKTHWPDHKGLCRPENIGYPFLVSVPASRLTYARLAQLLEGYAR RYSVSVFQPPFQPGRMALESQSPGCTTLLSTSSLEAGDS

EREPIQPSELQLVTPVAEGDTGAHRVWPPADRGPVPSTSGLSSEMLASGPIEGCPLLAGERVSRPEA AAVPGYQHSSESVNTHTPQFFIYKIDASNREQ

RLEDKG GETPLELGDDCSLALVWRNNERLQEFVLVASKELECAEDPGSAGEAARAGHFTLDQCLNLFTRPEVLAPEEAW WYCPQCKQHREASKQLLLW

RLPNVLIVQLKRFSFRSFIWRDKINDLVEFPVR RNLDLSKFCIGQKEEQLPSYDLYAVINHYGGMIGGHYTACARLPNDRSSQRSDVG GWRLFDDSTV

TTVDESQVVTRYAYVLFYRRRNSPVERPPRASHSEHHPDLGPAAEAAASQ - UNI2289 - ASRIWQELEAEEEMVPEGPGPLGPWGPQDWVGPPPRG

PTTPDEGCLRYFVLGTVAALVALVLNVFYPLVSQSRWR

For any suggestions or comments, please send an email to unitrap@crg.es