Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000006715 (Gmnn)
Chromosomal location
Chr 13: 24843714 - 24853806 (-)
Description
geminin Gene [Source:MGI (curated);Acc:Gmnn-001]
RefSeq_dna
NM_020567 
RefSeq_peptide
NP_065592.1 
UniGene
Mm.12239 
MGI
MGI:1927344 
Uniprot/SWISSPROT
O88513 
Uniprot/SPTREMBL
Q3V295 
Human Ortholog
ENSG00000112312 (GMNN)
Omim not available
UniTrap UNI3484
Vector Insertion
Chr 13: 24853681 - 24853731
Public Clones XT0615 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19696
Vector Insertion
Chr 13: 24852087 - 24853455
Public Clones E022G10 (ggtc) D008F03 (ggtc)
Private Clones OST383494 (lexicon) OST136672 (lexicon) OST30785 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18200
Vector Insertion
Chr 13: 24848605 - 24849464
Public Clones not available
Private Clones OST427650 (lexicon) OST291153 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15583
Vector Insertion
Chr 13: 24845526 - 24848605
Public Clones PST3082-NR (escells)
Private Clones OST33018 (lexicon)
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5188
Vector Insertion
Chr 13: 24845328 - 24845526
Public Clones YTC141 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8024
Vector Insertion
Chr 13: 24844100 - 24845216
Public Clones RRJ050 (baygenomics) STA057 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17896
Vector Insertion
Chr 13: 24844100 - 24845216
Public Clones not available
Private Clones OST434120 (lexicon)
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000006898
Sequence
AGGGCCTTGTGCGGCTCTCACGCTCGCCGGGAACTGAGCATTGCTGTCTGTGAGTCCGAGGGCGCGGGAGACCGAGGGCGGGGCGAGTGCAACTCCGGCC

GCGGGATCGCCGGGCTGGCCCGAATGCCCGGCCTGCTTCTCAGCCACGGGGAGCCGGCCTGGGAGGCGACGATTTGAAGGGACCCGAGTCTGGGGACTTG

AAAGGGACCCGAGTCTCGGCCCGACTGCAAGGCAAAGCTGGGCGAGCTGAGACGAGGGGCTGCGCCATTGGTGAG - UNI19696 - CTGAAAAATGA

ATCTCAGTATGAAGCAGAAGCAGGAGGGAGCCCAAGAGAATGTGAAG AATAGTCCTGTCCCAAGGAGAACGCTGAAGATGATCCAGCCTTCTGCAGATG

GATCTCTTGTTGGCAGAGAAAATGAG - UNI15583 - - UNI18200 - TTGCCAAAAGGCTTGTTCAAAAGGAAGCTTTGGGATGACCAGCTAGC

ATCTCAGACTTCAAGCTGTGGTCCAGAAGCTAATGAAAATAAGGATGTTGGAGACCTCACCCAGGAAGCCTTTGATCTTATAAGTAAAG - UNI15583

 - AGAACCCATCTTCTCAGTATTGGAAAGAAGTGGCAGAGCAGCGGAGGAAAGCTCTCTACGAAGCGCTGAAAGAGAATGAGAAA - UNI5188 - -

 UNI15583 - CTTCATAAAGAAATTGAACAAAAGGACAGTGAGATTGCCCGCCTGAGAAAGGAGAATAAAGACTTGGCAGAAGTAGCTGAGCACGTGC

AGTACATGGCGGAGGTAATCGAG - UNI8024 - - UNI17896 - AGGCTGAGTAATGAACCTCTGGATAACTTTGAATCACCGGATAGTCAGGAA

TTTGATTCTGAAGAAGAAGCTGTTGAGTATTCAGAACTGGAAGACTCAGGAGCTGGGACGTGTGCTGAAGAGACTGTGTCTTCCTCCACGGATGCTAGGC

CGTGTACATGAGGTGTGGGACGCACTGCCAGCGTTGCCCTTTAGTATAGCTCTTGGTAAACTAACTACACGGTGCAAGTGCTGGAAGCCAGGTTTGAATC

CTGGGGCTATCACTATGTTAAAATACAGATAGTGTGTATTTTTAATCCGTTTTATGTAAATAGCATTTTCATTTTTGTCAGTGTCAGATATAAACTGTAT

ATTAAATAAACTTCAATTTCCTGTTGAACATTGTA
Translation
 - UNI19696 - MNLSMKQKQEGAQENVK NSPVPRRTLKMIQPSADGSLVGRENE - UNI15583 - - UNI18200 - LPKGLFKRKLWDDQL

ASQTSSCGPEANENKDVGDLTQEAFDLISKE - UNI15583 - ENPSSQYWKEVAEQRRKALYEALKENEK - UNI5188 - - UNI15583 - L

HKEIEQKDSEIARLRKENKDLAEVAEHVQYMAEVIE - UNI8024 - - UNI17896 - RLSNEPLDNFESPDSQEFDSEEEAVEYSELEDSGAGTC

AEETVSSSTDARPCT
Transcript ENSMUST00000110382
Sequence
GCGCGTCAGCTACCGGGTCGGCGGGTTAGTCTGCAGGTTCGGGTCGTTCTGGCGTCGTTGAATCCGGTGTGGTGCCAGGGCCTTGTGCGGCTCTCACGCT

CGCCGGGAACTGAGCATTGCTGTCT - UNI3484 - - UNI19696 - CTGAAAAATGAATCTCAGTATGAAGCAGAAGCAGGAGGGAGCCCAAGAG

AATGTGAAG AATAGTCCTGTCCCAAGGAGAACGCTGAAGATGATCCAGCCTTCTGCAGATGGATCTCTTGTTGGCAGAGAAAATGAG - UNI15583 

- - UNI18200 - TTGCCAAAAGGCTTGTTCAAAAGGAAGCTTTGGGATGACCAGCTAGCATCTCAGACTTCAAGCTGTGGTCCAGAAGCTAATGAAA

ATAAGGATGTTGGAGACCTCACCCAGGAAGCCTTTGATCTTATAAGTAAAG - UNI15583 - AGAACCCATCTTCTCAGTATTGGAAAGAAGTGGCA

GAGCAGCGGAGGAAAGCTCTCTACGAAGCGCTGAAAGAGAATGAGAAA - UNI5188 - - UNI15583 - CTTCATAAAGAAATTGAACAAAAGGA

CAGTGAGATTGCCCGCCTGAGAAAGGAGAATAAAGACTTGGCAGAAGTAGCTGAGCACGTGCAGTACATGGCGGAGGTAATCGAG - UNI8024 - - 

UNI17896 - AGGCTGAGTAATGAACCTCTGGATAACTTTGAATCACCGGATAGTCAGGAATTTGATTCTGAAGAAGAAGCTGTTGAGTATTCAGAACT

GGAAGACTCAGGAGCTGGGACGTGTGCTGAAGAGACTGTGTCTTCCTCCACGGATGCTAGGCCGTGTACATGAGGTGTGGGACGCACTGCCAGCGTTGCC

CTTTAGTATAGCTCTTGGTAAACTAACTACACGGTGCAAGTGCTGGAAGCCAGGTTTGAATCCTGGGGCTATCACTATGTTAAAATACAGATAGTGTGTA

TTTTTAATCCGTTTTATGTAAATAGCATTTTCATTTTTGTCAGTGTCAGATATAAACTGTATATTAAATAAACTTCAATTTCCTGTTGAACATTGT
Translation
 - UNI3484 - - UNI19696 - MNLSMKQKQEGAQENVK NSPVPRRTLKMIQPSADGSLVGRENE - UNI15583 - - UNI18200 - LPK

GLFKRKLWDDQLASQTSSCGPEANENKDVGDLTQEAFDLISKE - UNI15583 - ENPSSQYWKEVAEQRRKALYEALKENEK - UNI5188 - - 

UNI15583 - LHKEIEQKDSEIARLRKENKDLAEVAEHVQYMAEVIE - UNI8024 - - UNI17896 - RLSNEPLDNFESPDSQEFDSEEEAVE

YSELEDSGAGTCAEETVSSSTDARPCT

For any suggestions or comments, please send an email to unitrap@crg.es