Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000006931 (1110036O03Rik)
Chromosomal location
Chr 11: 100269770 - 100276011 (-)
Description
RIKEN cDNA 1110036O03 gene Gene [Source:MGI Symbol;Acc:MGI:1913430]
Human Ortholog
not available
Omim not available
UniTrap UNI37900
Vector Insertion
Chr 11: 100274922 - 100275394
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37334
Vector Insertion
Chr 11: 100272512 - 100273042
Public Clones CMHD-GT_437A5-3 (cmhd) CMHD-GT_437F5-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107402
Sequence
GTCGCCGGCTGCTCCGTAAGCCTCCGGGCGCGGTGCGGGCATGGCTCGCGGGGCGTGGGGGCTGCTGTGGCTGCTGCTGGGCAGCGCCGGGGCCCAGTAC

GAGAAATACAGCTTCCGAGGATTCCCTCCGGAGGACCTGATGCCACTGGCCACGGCCTACGGCCACGCTCTGGAGCAATACGAAGGCGAAAGCTGGCGCG

AGAGCGCGCGCTACCTGGAGGCGGCGCTGCGGCTGCACCGGCTGCTGCGCGACAGCGAGGCCTTCTGCCA CCAACTGTAGTGGCCCCGCCACCTCTCAG

CCTCGGCCCGCGT GGCCCGGACGGCGACCACGACGGCGATGGCGAGGACTGGGCTCGCGAGCTGCGGCTCTTCGGTCACGTCCTGGAGCGCGCCGCCTG

CCTGCGGCGCTGCAAGAAGACGCTGCCCGCCTTTCAAGTCCCTTACCCACCGCGGCAGCTGCTGCGCGACTTCCAGAGCCGCCTGCCCTATCAGTACCTG

CACTACGCGCACTTCAAG GCGAACCGACTGGAGAAGGCGGTGGCTGCGGCCTACACCTTCCTCCAGAGGAACCCCAAGCACGAGCTGACCGCCAAGTAT

CTCAACTACTACAGGGGGATGCTGGATATTGGAGATGAGTCCCTCACCGACCTGGAGGCCCAGCCCTACGAG GCTGTGTTCCTCCGGGCTGTGAAACTT

TACAACAGCGGGGACTTTCGCAGCAGCACAGAAGACATGGAGCGGGCCCTGGCTGAATATATGACGGTCTTTGCTCGGTGTCTAGCTGGCTGTGAGGGGG

CCCACGAGCAGGTAGACTTCAAGGACTTCTACCCAGCGATAGCAG ATCTCTTCGCAGAATCCCTGCAGTGCAAGGTGGACTGTGAGACCAATCTCACCC

CCAACGTAGGTGGCTTCTTTGTGGACAAGTTTGTGGCCACCATGTATCACTACCTGCAGTTTGCCTACTACAAAC TGAATGATGTACGCCAGGCTGCCC

GCAGTGCTGCTAGCTACATGCTCTTTGACCCCAAGGACAGCGTTATGCAGCAGAACCTGGTATATTACCGCTTCCACCGGGCTCGCTGGGGCCTTGAAGA

CGAGGACTTTCAACCCCGGGAG - UNI37334 - GAAGCTATGCTCTACCACAACCAGACCTCTGAGCTCCGGGAGTTGCTAGACTTCACACACATGT

ACCTTCAGTCAGACGATGAG ATGGAACTGGAGGAGACAGAATCACTCCCAGAGCCTGAAGAACCTCTATCTGATGCTGAGTTCGAAGGCGAGGGCGACT

ATGAGGAAGGTCTCTATGCTGACTGGTGGCAAGAGCCAGAAGCCAAGGGTGACGAGGCCGAGGCCG AGCCAGAGCCTGAACTGACATAAGGCGGTGACA

TGGCGCACTCTTCAAGCTCAGGACACCTGGCTGGGGGCAAGAACTATTTATTAAAACTTAAAATAGCCAGGTGTGGTGGCACACACCCTTAACCCTGGCA

CCCGGGGGAGGCAGAAGCAGGCAGATCTCGGGACCAGCCCAGCCTACACAGTGAGATCCTGGCCAGGCCAGGCTACATAATGAGATTTTGTTTCAAAACA

AAAACAACTGAGTGTGGCATCACATGCCTTTAATTGCAGCAGCTGGGATGCAGGGGCAGGTGGATTGCGGTGAGTTTCAGGCTAGCCTGTAGTGAGTTCT

AGGCCAGTAGAGGCTCTGTTGTAAGACCCTGTCTCAAAATAAAACAAAAGGAAAAACCTTAAAAGGGACACAGTTGACCTAGTTTCCACTCAGCCTCCAC

CTTAGCTCTCTCTCTCTCTCTTGTGTCTTTGAACCGCAGACTGGTAGCCATATTGCTGGTTGGGAAGTGAGCTCTTGGGGGTCTCTGTCTCCCTTTCTGC

TCCTGCGGAAGTTTTCAGCTTCCGGCTTGAGTCTCACAGGACCAAGGCCAGCCAGGTGGCGGTTGTGTCTGAGCTGCAGAGTGGGTTGTGAAGAACATTG

GGCTTAGAGCTCTGCTGCTCAATAAATGTTTATTGTTGAAATGAATCATAACACCT
Translation
VAGCSVSLRARCGHGSRGVGAAVAAAGQRRGPVREIQLPRIPSGGPDATGHGLRPRSGAIRRRKLARERALPGGGAAAAPAAARQRGLLP PTVVAPPPL

SLGPR GPDGDHDGDGEDWARELRLFGHVLERAACLRRCKKTLPAFQVPYPPRQLLRDFQSRLPYQYLHYAHFK ANRLEKAVAAAYTFLQRNPKHELTA

KYLNYYRGMLDIGDESLTDLEAQPYE AVFLRAVKLYNSGDFRSSTEDMERALAEYMTVFARCLAGCEGAHEQVDFKDFYPAIAD DLFAESLQCKVDCE

TNLTPNVGGFFVDKFVATMYHYLQFAYYKL LNDVRQAARSAASYMLFDPKDSVMQQNLVYYRFHRARWGLEDEDFQPRE - UNI37334 - EAMLYH

NQTSELRELLDFTHMYLQSDDE MELEETESLPEPEEPLSDAEFEGEGDYEEGLYADWWQEPEAKGDEAEAE EPEPELT
Transcript ENSMUST00000066489
Sequence
GGTCGCCGGCTGCTCCGTAAGCCTCCGGGCGCGGTGCGGGCATGGCTCGCGGGGCGTGGGGGCTGCTGTGGCTGCTGCTGGGCAGCGCCGGGGCCCAGTA

CGAGAAATACAGCTTCCGAGGATTCCCTCCGGAGGACCTGATGCCACTGGCCACGGCCTACGGCCACGCTCTGGAGCAATACGAAGGCGAAAGCTGGCGC

GAGAGCGCGCGCTACCTGGAGGCGGCGCTGCGGCTGCACCGGCTGCTGCGCGACAGCGAGGCCTTCTGCCACGCCAACTGTAGTGGCCCCGCCACCTCTC

AGCCTCGGCCCGCGTCCGGCCCGGACGGCGACCACGACGGCGATGGCGAGGACTGGGCTCGCGAGCTGCGGCTCTTCGGTCACGTCCTGGAGCGCGCCGC

CTGCCTGCGGCGCTGCAAGAAGACGCTGCCCGCCTTTCAAGTCCCTTACCCACCGCGGCAGCTGCTGCGCGACTTCCAGAGCCGCCTGCCCTATCAGTAC

CTGCACTACGCGCACTTCAAG GCGAACCGACTGGAGAAGGCGGTGGCTGCGGCCTACACCTTCCTCCAGAGGAACCCCAAGCACGAGCTGACCGCCAAG

TATCTCAACTACTACAGGGGGATGCTGGATATTGGAGATGAGTCCCTCACCGACCTGGAGGCCCAGCCCTACGAG GCTGTGTTCCTCCGGGCTGTGAAA

CTTTACAACAGCGGGGACTTTCGCAGCAGCACAGAAGACATGGAGCGGGCCCTGGCTGAATATATGACGGTCTTTGCTCGGTGTCTAGCTGGCTGTGAGG

GGGCCCACGAGCAGGTAGACTTCAAGGACTTCTACCCAGCGATAGCAG ATCTCTTCGCAGAATCCCTGCAGTGCAAGGTGGACTGTGAGACCAATCTCA

CCCCCAACGTAGGTGGCTTCTTTGTGGACAAGTTTGTGGCCACCATGTATCACTACCTGCAGTTTGCCTACTACAAAC TGAATGATGTACGCCAGGCTG

CCCGCAGTGCTGCTAGCTACATGCTCTTTGACCCCAAGGACAGCGTTATGCAGCAGAACCTGGTATATTACCGCTTCCACCGGGCTCGCTGGGGCCTTGA

AGACGAGGACTTTCAACCCCGGGAG - UNI37334 - GAAGCTATGCTCTACCACAACCAGACCTCTGAGCTCCGGGAGTTGCTAGACTTCACACACA

TGTACCTTCAGTCAGACGATGAG ATGGAACTGGAGGAGACAGAATCACTCCCAGAGCCTGAAGAACCTCTATCTGATGCTGAGTTCGAAGGCGAGGGCG

ACTATGAGGAAGGTCTCTATGCTGACTGGTGGCAAGAGCCAGAAGCCAAGGGTGACGAGGCCGAGGCCG AGCCAGAGCCTGAACTGACATAAGGCGGTG

ACATGGCGCACTCTTCAAGCTCAGGACACCTGGCTGGGGGCAAGAACTATTTATTAAAACTTAAAATAGCCAGGTGTGGTGGCACACACCCTTAACCCTG

GCACCCGGGGGAGGCAGAAGCAGGCAGATCTCGGGACCAGCCCAGCCTACACAGTGAGATCCTGGCCAGGCCAGGCTACATAATGAGATTTTGTTTCAAA

ACAAAAACAACTGAGTGTGGCATCACATGCCTTTAATTGCAGCAGCTGGGATGCAGGGGCAGGTGGATTGCGGTGAGTTTCAGGCTAGCCTGTAGTGAGT

TCTAGGCCAGTAGAGGCTCTGTTGTAAGACCCTGTCTCAAAATAAAACAAAAGGAAAAACCTTAAAAGGGACACAGTTGACCTAGTTTCCACTCAGCCTC

CACCTTAGCTCTCTCTCTCTCTCTTGTGTCTTTGAACCGCAGACTGGTAGCCATATTGCTGGTTGGGAAGTGAGCTCTTGGGGGTCTCTGTCTCCCTTTC

TGCTCCTGCGGAAGTTTTCAGCTTCCGGCTTGAGTCTCACAGGACCAAGGCCAGCCAGGTGGCGGTTGTGTCTGAGCTGCAGAGTGGGTTGTGAAGAACA

TTGGGCTTAGAGCTCTGCTGCTCAATAAATGTTTATTGTTGAAATGAATCATAACACCT
Translation
MARGAWGLLWLLLGSAGAQYEKYSFRGFPPEDLMPLATAYGHALEQYEGESWRESARYLEAALRLHRLLRDSEAFCHANCSGPATSQPRPASGPDGDHDG

DGEDWARELRLFGHVLERAACLRRCKKTLPAFQVPYPPRQLLRDFQSRLPYQYLHYAHFK ANRLEKAVAAAYTFLQRNPKHELTAKYLNYYRGMLDIGD

ESLTDLEAQPYE AVFLRAVKLYNSGDFRSSTEDMERALAEYMTVFARCLAGCEGAHEQVDFKDFYPAIAD DLFAESLQCKVDCETNLTPNVGGFFVDK

FVATMYHYLQFAYYKL LNDVRQAARSAASYMLFDPKDSVMQQNLVYYRFHRARWGLEDEDFQPRE - UNI37334 - EAMLYHNQTSELRELLDFTH

MYLQSDDE MELEETESLPEPEEPLSDAEFEGEGDYEEGLYADWWQEPEAKGDEAEAE EPEPELT

For any suggestions or comments, please send an email to unitrap@crg.es