Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000007080 (Pole)
Chromosomal location
Chr 5: 110715360 - 110766472 (+)
Description
polymerase (DNA directed), epsilon Gene [Source:MGI (curated);Acc:Pole-001]
RefSeq_dna
NM_011132 
RefSeq_peptide
NP_035262.2 
UniGene
Mm.35061 
MGI
MGI:1196391 
Uniprot/SWISSPROT
Q9WVF7 
Uniprot/SPTREMBL
Q3TBY2 Q3TMK8 Q3UPI9 Q3UR94 Q3UWI6 Q80XH7 Q8CD66 
Human Ortholog
ENSG00000177084 (POLE)
Omim not available
UniTrap UNI22123
Vector Insertion
Chr 5: 110715469 - 110718251
Public Clones IST10117B3 (tigm) IST14995G6 (tigm)
Private Clones OST307866 (lexicon) OST146932 (lexicon) OST102998 (lexicon) OST74210 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20842
Vector Insertion
Chr 5: 110718394 - 110718800
Public Clones not available
Private Clones OST350313 (lexicon) OST195556 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21193
Vector Insertion
Chr 5: 110718882 - 110719244
Public Clones not available
Private Clones OST339077 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3693
Vector Insertion
Chr 5: 110741834 - 110741924
Public Clones AG0038 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31956
Vector Insertion
Chr 5: 110747779 - 110752556
Public Clones IST14264B9 (tigm) IST12672D8 (tigm) IST14440H3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9059
Vector Insertion
Chr 5: 110760090 - 110761400
Public Clones XK134 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112481
Sequence
CCAGTGACATGACAGAGGCAGTGGACCTGGGCTTGCCCTGGCTTTCCTCTTGGTCATTACCGGGCAGTTGTTTACAGGCAGCTCCTTCAGTATGCTAGGA

AGTTTGGGGGACTGTCTGAATCCACTTGAAGTTCATTT CATCCATTCTAAAGAGATCTTCCATTCCCTGACCATCTCTTTCTCTCGATGCTGGGAATTC

CTTCTCTGGATGGATCCATCCAACTATGGTGGAATCAAAGGAAAAGTTCCATCTAGTATTCACTGTGGACAGGTAAAAGAG - UNI9059 - CAAGAC

TCCCAGGCAAGAGAGGAAACTGATGAAGAGGAGGAGGACAAGGAAAAGGACGAGGAGGAAGAGGGCATGGGAGAGTCCGAGGTTGAGGACTTACTGGAGA

ACAACTGGAACATTCTACAGTTCTTGCCCCAGGCAGCCTCTTGCCAGAGCTACTTCCTCATGATTGTTTCAG CATACATCGTAGCTGTGTACCAAAGCA

TGAAGGAGGAGTTGAGACACAGTGCCCCGGGCAGTACCCCTGTGAAGAGGAAGGGGGCCAGCCAGTTCTCCCAGGAGTCTGAAGGGGCAACTGGATCTCT

TCCTG GAATGATCACTTTCTCTCAAGATTATGTGGCAAATGAGCTCACTCAGAGCTTCTTCACCATTACTCAGAAAATTCAGAAGAAAGTCACAGGTTC

TCGGAACACCACTGAGCCCTCAGAGATGTTCCCCGTCCTCCCTGGTTCACACTTGCTGCTCAATAATCCTGCTCTGGAGTTCATCAAATATGTGTGCAAG

 GTACTATCTCTGGATACAAACATCACAAATCAGGTGAATAAGCTGAACAGAGACCTTCTTCGCCTGGTAGACGTTGGTGAATTCTCTGAGGAGGCCCAG

TTCAGAGACCCCTGCCACTCCTACGTGCTCCCTGAGGTAATCTGCCACAGCTGTAATTTCTGCCGAGACCTGGACCTGTGCAAAGATTCCTCTTTCTCTC

AG GATGGAGCCATCCTGCCTCAGTGGCTCTGCTCCAATTGTCAAGCCCCCTATGACTCCTCTGCCATTGAGTCAGCCTTGGTGGAAGCCCTGCAGAGGA

AACTGATGGCCTTCACACTTCAGGACCTG GTATGCCTCAAGTGCCGTGGTATGAAAGAGACCCATATGCCTGTGTACTGCAGCTGCGCAGGGGACTTTA

CTCTCACCATCCGCACTGAG GTCTTCATGGAACAGATTAGAATCTTCCAGAACATTGCCAAGTACTACAGCATGTCATATCTCCAGGAGACCATAGAAT

GGCTGTTACAGACAAGCCCTGTATCAAACTGTTAGCAAGCCTAGGCTAAAGACACTTTGGTATCCCACACCTACTGCCTGCTCCAAAAGGCAGAACCACT

GACCACCTTGCTTTTCCAAACTCATGAGCACAGCCCAGAAGGAACAGAAGACTTCTGCTAACGTCATCATGCCATAAACAGACAGAAGCAGGGAATGGCT

CTATCCCTAGCTGCCTGCTAAGTAAACACGGTTTTGAAGCGTC
Translation
MLGSLGDCLNPLEVHF FIHSKEIFHSLTISFSRCWEFLLWMDPSNYGGIKGKVPSSIHCGQVKE - UNI9059 - QDSQAREETDEEEEDKEKDEEE

EGMGESEVEDLLENNWNILQFLPQAASCQSYFLMIVSA AYIVAVYQSMKEELRHSAPGSTPVKRKGASQFSQESEGATGSLPG GMITFSQDYVANELT

QSFFTITQKIQKKVTGSRNTTEPSEMFPVLPGSHLLLNNPALEFIKYVCK VLSLDTNITNQVNKLNRDLLRLVDVGEFSEEAQFRDPCHSYVLPEVICH

SCNFCRDLDLCKDSSFSQ DGAILPQWLCSNCQAPYDSSAIESALVEALQRKLMAFTLQDL VCLKCRGMKETHMPVYCSCAGDFTLTIRTE VFMEQIR

IFQNIAKYYSMSYLQETIEWLLQTSPVSNC
Transcript ENSMUST00000112482
Sequence
GCGCGCCAAATTCTCCCCGGAGCCTGAGGGAGCTTTGGAGCGTCGCAATGGTCCTGAGGAACAGTGGACGGAGGCACCCCGAGCCGGGCGCGGATGGCGA

AGGCAGCCG - UNI22123 - GGATGATGGTCCCTCTTCCTCAGTCTCAGCACTCAAGCGTCTGGAACGGAGCCAGTGGACAGACAAGATGGACTTAC

GGTTTGGTTTCGAAAGGCTGAAAGAGCCTGGAGAAAGGACTGGCTGGCTGATCAACATGCACCCT - UNI20842 - ACTGAGATCTTAGATGAAGAC

AAACGCTTAGTCAGCGCGGTGGATTACTACTTCATTCAAGATGATGGAAGCAGATTTAAG - UNI21193 - GTGGCCTTGCCCTATATGCCGTATTT

CTACATTGCAGCGAGAAAG GGTTGTGATCGAGAAGTTTCATCTTTTCTATCCAAGAAGTTTCAGGGAAAAATTGCAAAGTTAGAGAATGTGCCCAAAGA

AGATCTGGACTTG CCAAATCACTTGGTGGGCTTGAAGCGGAGTTACATCAAGCTGTCCTTCCACACTGTGGAGGACCTTGTCAAAGTGAGAAAGGAGAT

CTCTCCTGCTGTGAAGAAGAACCGAGAGCAGGACCATGCTAGTGATGAGTATACAACAATGCTCTCCAGGTAACTTTCCTTCTCAAGAGCAAAGTGCCAG

TTACTCCAGAATAACAAGCTAATGGAGGCAGGAACTCTTCAGAGAGACTCCCCGGGTGCTTGGCATGTGTAAATAAACACTGGCTTCCCAA
Translation
MVLRNSGRRHPEPGADGEGSR - UNI22123 - RDDGPSSSVSALKRLERSQWTDKMDLRFGFERLKEPGERTGWLINMHP - UNI20842 - TEI

LDEDKRLVSAVDYYFIQDDGSRFK - UNI21193 - VALPYMPYFYIAARK GCDREVSSFLSKKFQGKIAKLENVPKEDLDL PNHLVGLKRSYIKL

SFHTVEDLVKVRKEISPAVKKNREQDHASDEYTTMLSR
Transcript ENSMUST00000007296
Sequence
CGCAATGGTCCTGAGGAACAGTGGACGGAGGCACCCCGAGCCGGGCGCGGATGGCGAAGGCAGCCG - UNI22123 - GGATGATGGTCCCTCTTCCT

CAGTCTCAGCACTCAAGCGTCTGGAACGGAGCCAGTGGACAGACAAGATGGACTTACGGTTTGGTTTCGAAAGGCTGAAAGAGCCTGGAGAAAGGACTGG

CTGGCTGATCAACATGCACCCT - UNI20842 - ACTGAGATCTTAGATGAAGACAAACGCTTAGTCAGCGCGGTGGATTACTACTTCATTCAAGATG

ATGGAAGCAGATTTAAG - UNI21193 - GTGGCCTTGCCCTATATGCCGTATTTCTACATTGCAGCGAGAAAG GGTTGTGATCGAGAAGTTTCATC

TTTTCTATCCAAGAAGTTTCAGGGAAAAATTGCAAAGTTAGAGAATGTGCCCAAAGAAGATCTGGACTTG CCAAATCACTTGGTGGGCTTGAAGCGGAG

TTACATCAAGCTGTCCTTCCACACTGTGGAGGACCTTGTCAAAGTGAGAAAGGAGATCTCTCCTGCTGTGAAGAAGAACCGAGAGCAGGACCATGCTAGT

GATGAGTATACAACAATGCTCTCCAG TATTCTGCAAGGTGGCAGTGTAATTACTGATGAGGACGAAACCTCTAAGAAGATAGCTGACCAATTGGACAAC

ATAGTGGACATGCGAGAGTATGATGTTCCCTACCACATTCGCCTCTCCATTGACCTCAGAATCCATGTG GCCCACTGGTACAATGTTAGATTTCGAGGA

AATGCTTTTCCTGTGGAAATCACCCGACGAGATGATCTTGTTGAACGACCT GACCCTGTGGTTTTGGCATTTGACATCGAGACGACCAAACTGCCTCTC

AAATTCCCTGATGCTGAGACCGATCAGATCATGATGATCTCCTATATGATTGATGGCCAG GGCTACCTCATCACTAACAGGGAGATTGTTTCAGAAGAT

ATTGAAGATTTTGAGTTCACCCCTAAGCCAGAATATGAAGGGCCCTTTTGTGTCTTCAATGAACCCGACGAG GTCCATCTGATCCAGAGATGGTTTGAG

CATATCCAGGAAACCAAACCTACCATTATGGTCACCTACAATGGGGATTTTTTTGACTG GCCATTTGTGGAGGCTAGGGCAGCAATTCATGGCCTCAGC

ATGTACCAGGAGATAGGCTTCCAGAAGGATAGCCAGGGGGAATATAAGGCACCACAGTGCATCCACATGGACTGCCTCAG GTGGGTGAAGAGGGACAGT

TACCTTCCTGTGGGCAGTCATAATCTCAAGGCAGCTGCCAAGGCCAAACTTGGCTATGACCCTGTAGAGCTGGACCCTGAGGACATGTGTCGTATGGCCA

CTGAACAGCCCCAG ACTCTGGCCACTTACTCAGTGTCAGATGCTGTGGCTACTTACTACCTGTACATGAAATACGTCCACCCCTTCATATTCGCCCTGT

GCACCATTATTCCCATGGAACCTGATGAG GTGCTGCGGAAGGGCTCCGGGACACTGTGTGAAGCCTTGCTGATGGTGCAAGCTTTCCATGCCAACATTA

TCTTCCCCAATAAGCAAGAGCAGGAGTTCAACAAGCTGACAGATGATGGCCACATGCTAGATGCTGAGACCTACGTCGGGGGCCACGTGGAGGCACTAGA

GTCTGGTGTCTTCAGAAGTGATATCCCCTGCCGGTTTAGGATG AATCCTGCAGCCTTTGATTTCCTGCTGCAACGAGTCGAGAAGACTATGCGCCACGC

CATTGAAGAAGAAGAGAAGGTGCCTGTGGAACAAGCCACCAACTTTCAAGAG GTGTGTGAGCAGATTAAGACCAAGCTCACCTCCCTAAAAGATGTTCC

TAACAGAATTGAATGTCCTCTAATCTACCATCTAGATGTGGGGGCCATGTATCCTAACATAATTCTTACCAACCGCCTACAG CCTTCTGCCATAGTGGA

TGAGGCCACCTGTGCTGCCTGTGACTTCAATAAGCCTGGAGCAAGTTGTCAGAGGAAGATGGCCTGGCAGTGGAGGGGAGAATTCA TGCCAGCCAGTCG

CAGTGAATACCATCGGATTCAGCATCAGCTGGAGTCGGAGAAGTTTCCCCCTTTGTTTCCAGAGGGGCCAGCACGGGCCTTTCACGAGCTGTCCCGTGAA

GAACAGGCTAAATACGAGAAGAGGAGGCTGGCAG ATTATTGCCGGAAAGCCTATAAGAAGATCCATGTGACCAAGGTAGAAGAACGTCTAACTACCATC

TGCCAGCGGGAAAACTCATTTTATGTGGACACAGTGCGGGCCTTCAGAGACAGGCGCTATGAGTTCAAAGGACTGCACAAG GTGTGGAAGAAGAAGCTC

TCGGCAGCTGTAGAGGTGGGCGATGCATCAGAGGTGAAGCGCTGCAAGAACATGGAGATCCTTTACGATTCACTGCAGCTGGCTCACAAGTGCATCCTGA

ACTCCTTCTACGGCTATGTCATGCGCAAAGG AGCTCGCTGGTATTCCATGGAGATGGCTGGTATCGTCTGCTTTACAGGAGCCAACATCATCACCCAAG

CAAGAGAACTGATTGAGCAGATCGG GAGGCCTTTAGAATTGGACACGGACGGAATATGGTGCGTCCTACCCAATAGCTTTCCTGAAAATTTTGTCATCA

AGACAACCAATGCGAAGAAACCCAAACTGACCATCTCCTATCCTGGTGCCATGTTGAACATCATGGTCAAG GAAGGCTTTACCAACCACCAGTACCAGG

AACTAACAGAGCCTTCGTCTCTCACCTATGTCACCCACTCTGAGAATAGTATCTTTTTTGAAGTCGATGGACCATACCTTGCTATGATCCTTCCAGCCTC

CAAGGAAGAAGGCAAGAAGCTGAAGAAAAG ATATGCTGTGTTCAATGAAGATGGTTCCTTGGCTGAACTGAAAGGTTTTGAGGTGAAACGCCGAGGGGA

GTTGCAGCTGATTAAAATATTCCAGTCCTCAGTTTTTGAGGCCTTCCTCAAGGGCAGCACACTGGAGGAAGTGTATGGCTCGGTGGCCAAAGTGGCTGAC

TACTGGCTAGATGTGCTCTATAGCAAG GCTGCTAATATGCCCGATTCTGAATTGTTTGAGCTGATTTCTGAGAACCGCTCCATGTCTCGGAAGCTGGAA

GATTACGGGGAGCAGAAGTCTACATCCATCAGCACAGCAAAGCGCCTGGCTGAGTTCCTGGGAGACCAGATGGTCAAAGATGCTGGACTGAGCTGCCGCT

ATATCATCTCCCGAAAGCCAGAGGGGTCTCCTGTCACTGAGAG GGCCATTCCACTTGCCATTTTCCAAGCAGAGCCTACAGTGAGGAAACATTTTCTCC

GGAAATGGCTAAAGAGTTCATCACTTCAAGACTTTGATATTCGGACA ATTCTGGACTGGGACTACTACATAGAGAGGCTGGGGAGTGCCATCCAGAAAA

TCATCACCATCCCCGCAGCTCTGCAGCAG - UNI3693 - GTGAAGAACCCAGTTCCACGTGTCAAACATCCAGACTGGCTACACAAAAAACTACTAG

AGAAGAATGATATCTACAAACAGAAGAAGATCAGTGAGCTCTTTGTGCTTGAAGGAAAGAGACAG ATTGTGATGGCCCAGGCTTCAGAAAACAGTCTGA

GTCTCTGCACTCCAGACATGGAGGACATTGGACTCACAAAGCCACACCACTCTACAGTCCCAGTTGCTACTAAGAGGAAGCGAGTCTGGGAGACCCAAAA

GGAGTCTCAGGATATTGCACTAACTGTGCCCTGGCAAGAGGTCTTAGGGCAGCCTCCCTCCCTTGGAACCACACAG GAAGAGTGGTTGGTCTGGCTCCA

GTTCCACAAGAAAAAGTGGCAGCTGCAGGCCCAACAGCGCCTAGCCCTCAGGAAGAAGCAACGCTTAGAGTCAGCAGAAGATATGCCAAGGCTTGGGCCT

ATCCGAGAGGGGCCTTCCACAGGACTGGGGAGCTTTTTGCGAAGGACTGCCCGCAGCATCATGGACCTTCCATGGCAGATAATACAG ATCAGTGAGACC

AGACAGGCTGGTCTGTTCCGGCTGTGGGCTATCATTGGCAATGACTTGCACTGCATCAAGCTGAGTATCCCTCGAGTATTCTATGTAAACCAGCGGGTTG

CCAAAGCAGAGGATGGACCTGCATATCGGAAG - UNI31957 - GTGAATCGGGCTCTTCCTCGTTCCAACATTGTCTACAATCTCTATGAGTATTCA

GTACCAGAGGACATGTACCAAGAACACATCAACGAGATCAACACTGAGTTGTCAGTACCAGACATTGAGGGCGTGTATGAGACACAG GTCCCATTGTTA

TTCCGGGCCCTCGTGCAGCTGGGCTGTGTGTGTGTGGTCAACAAGCAGCTGACAAGGCACCTTTCGGGCTGGGAAGCTGAAACTTTTGCCCTCGAGCACC

TTGAAATGCGTTCTCTGGCCCAGTTCAGCTACTTGGAACCAG GGAGTATCCGCCATATCTACCTGTACCATCACACTCAGGGCCACAAGGCACTCTTTG

GGGTCTTTATCCCCTCACAGCGAAGAGCATCTGTGTTTGTGTTGGATACT GTACGAAGCAACCAAATGCCAGGGCTCAGTGCCCTGTACTCATCAGAAC

ACAGCCTGCTGCTGGACAAGGTGGACCCCAAGCTCCTGCCTCCCCCAAAACACACCTTTGAAGTTCGTGCTGAAACCAACCTGAAGACTATCTGCAGAGC

CATCCAGCGCTTCCTGCTTGCCTACAAG GAAGAGCGCCGAGGGCCCACACTCATCGCTGTCCAGTCTAGCTGGGAGCTGTGTAGGCTGACCAGTGAGAT

TCCAGTCTTAGAAGAGTTCCCACTAGTGCCTATCCGAGTGGCTGACAAGATCAGCTATGCAGTCCTGGACTGGCAGCGCCATGGAGCTCGCCGAATGATC

CGGCACTACCTCAATTTAGACTTGTGCCTGTCGCAGGCCTTTGAGATGAGCAG GTACTTCCACATCCCTGTTGGAAACCTGCCGGAAGACATCTCCACC

TTTGGCTCAGACCTCTTTTTTGCACGCCACCTCCAGCACCATAACCACCTGCTTTGGCTATCCCCTACCTCTCGGCCTGACCTGGGTGGGAAGGAAGCTG

ATGACAACCGCCTTGTCATGGAGTTTGATGACCGAGCCACTGTGGAGATCAATAGTTCTGGCTGTTACTCTACTG TGTGCGTGGAACTGGACATTCAAA

ATCTGGCAGTCAACACCATCCTCCAGTCCCATCATGTCAATGACATGGAGGGGGCTGGCAGCATGGGCATCAGCTTCGATGTGATCCAGCAGGCCTCCCT

AGAGGACATGGTAACAGGCAATCAAGCTGCCAGTGCCCTGGCCAACTACGATGAGACAGCCCTCTGCTCTAGTACCTTCAG GATCCTGAAGAGCATGGT

GGTTGGCTGGGTAAAGGAAATCACACAGTACCACAACATCTATGCTGACAACCAGGTAATGCACTTCTACCGCTGGCTCCAGTCACCGTGCTCTCTGCTC

CACGACCCAGCCCTTCACCGGACGCTGCACAACATGATGAAGAAGCTCTTCCTGCA GCTCATTGCTGAGTTCAAGCGCCTGGGGTCATCAGTCGTCTAT

GCCAACTTCAATCGCATCATTCTCTGTACAAAGAAGCGCCGAATAGAGGATGCCCTTGCCTATGTGGAATATATTACCAACAG CATCCATTCTAAAGAG

ATCTTCCATTCCCTGACCATCTCTTTCTCTCGATGCTGGGAATTCCTTCTCTGGATGGATCCATCCAACTATGGTGGAATCAAAGGAAAAGTTCCATCTA

GTATTCACTGTGGACAGGTAAAAGAG - UNI9059 - CAAGACTCCCAGGCAAGAGAGGAAACTGATGAAGAGGAGGAGGACAAGGAAAAGGACGAGG

AGGAAGAGGGCATGGGAGAGTCCGAGGTTGAGGACTTACTGGAGAACAACTGGAACATTCTACAGTTCTTGCCCCAGGCAGCCTCTTGCCAGAGCTACTT

CCTCATGATTGTTTCAG CATACATCGTAGCTGTGTACCAAAGCATGAAGGAGGAGTTGAGACACAGTGCCCCGGGCAGTACCCCTGTGAAGAGGAAGGG

GGCCAGCCAGTTCTCCCAGGAGTCTGAAGGGGCAACTGGATCTCTTCCTG GAATGATCACTTTCTCTCAAGATTATGTGGCAAATGAGCTCACTCAGAG

CTTCTTCACCATTACTCAGAAAATTCAGAAGAAAGTCACAGGTTCTCGGAACACCACTGAGCCCTCAGAGATGTTCCCCGTCCTCCCTGGTTCACACTTG

CTGCTCAATAATCCTGCTCTGGAGTTCATCAAATATGTGTGCAAG GTACTATCTCTGGATACAAACATCACAAATCAGGTGAATAAGCTGAACAGAGAC

CTTCTTCGCCTGGTAGACGTTGGTGAATTCTCTGAGGAGGCCCAGTTCAGAGACCCCTGCCACTCCTACGTGCTCCCTGAGGTAATCTGCCACAGCTGTA

ATTTCTGCCGAGACCTGGACCTGTGCAAAGATTCCTCTTTCTCTCAG GATGGAGCCATCCTGCCTCAGTGGCTCTGCTCCAATTGTCAAGCCCCCTATG

ACTCCTCTGCCATTGAGTCAGCCTTGGTGGAAGCCCTGCAGAGGAAACTGATGGCCTTCACACTTCAGGACCTG GTATGCCTCAAGTGCCGTGGTATGA

AAGAGACCCATATGCCTGTGTACTGCAGCTGCGCAGGGGACTTTACTCTCACCATCCGCACTGAG GTCTTCATGGAACAGATTAGAATCTTCCAGAACA

TTGCCAAGTACTACAGCATGTCATATCTCCAGGAGACCATAGAATGGCTGTTACAGACAAGCCCTGTATCAAACTGTTAGCAAGCCTAGGCTAAAGACAC

TTTGGTATCCCACACCTACTGCCTGCTCCAAAAGGCAGAACCACTGACCACCTTGCTTTTCCAAACTCATGAGCACAGCCCAGAAGGAACAGAAGACTTC

TGCTAACGTCATCATGCCATAAACAGACAGAAGCAGGGAATGGCTCTATCCCTAGCTGCCTGCTAAGTAAACACGGTTTTGAAGCGTC
Translation
MVLRNSGRRHPEPGADGEGSR - UNI22123 - RDDGPSSSVSALKRLERSQWTDKMDLRFGFERLKEPGERTGWLINMHP - UNI20842 - TEI

LDEDKRLVSAVDYYFIQDDGSRFK - UNI21193 - VALPYMPYFYIAARK GCDREVSSFLSKKFQGKIAKLENVPKEDLDL PNHLVGLKRSYIKL

SFHTVEDLVKVRKEISPAVKKNREQDHASDEYTTMLSS SILQGGSVITDEDETSKKIADQLDNIVDMREYDVPYHIRLSIDLRIHV AHWYNVRFRGNA

FPVEITRRDDLVERP DPVVLAFDIETTKLPLKFPDAETDQIMMISYMIDGQ GYLITNREIVSEDIEDFEFTPKPEYEGPFCVFNEPDE VHLIQRWFE

HIQETKPTIMVTYNGDFFDW WPFVEARAAIHGLSMYQEIGFQKDSQGEYKAPQCIHMDCLR RWVKRDSYLPVGSHNLKAAAKAKLGYDPVELDPEDMC

RMATEQPQ TLATYSVSDAVATYYLYMKYVHPFIFALCTIIPMEPDE VLRKGSGTLCEALLMVQAFHANIIFPNKQEQEFNKLTDDGHMLDAETYVGGH

VEALESGVFRSDIPCRFRM NPAAFDFLLQRVEKTMRHAIEEEEKVPVEQATNFQE VCEQIKTKLTSLKDVPNRIECPLIYHLDVGAMYPNIILTNRLQ

 PSAIVDEATCAACDFNKPGASCQRKMAWQWRGEFM MPASRSEYHRIQHQLESEKFPPLFPEGPARAFHELSREEQAKYEKRRLAD DYCRKAYKKIHV

TKVEERLTTICQRENSFYVDTVRAFRDRRYEFKGLHK VWKKKLSAAVEVGDASEVKRCKNMEILYDSLQLAHKCILNSFYGYVMRKG GARWYSMEMAG

IVCFTGANIITQARELIEQIG GRPLELDTDGIWCVLPNSFPENFVIKTTNAKKPKLTISYPGAMLNIMVK EGFTNHQYQELTEPSSLTYVTHSENSIF

FEVDGPYLAMILPASKEEGKKLKKR RYAVFNEDGSLAELKGFEVKRRGELQLIKIFQSSVFEAFLKGSTLEEVYGSVAKVADYWLDVLYSK AANMPDS

ELFELISENRSMSRKLEDYGEQKSTSISTAKRLAEFLGDQMVKDAGLSCRYIISRKPEGSPVTER RAIPLAIFQAEPTVRKHFLRKWLKSSSLQDFDIR

T ILDWDYYIERLGSAIQKIITIPAALQQ - UNI3693 - VKNPVPRVKHPDWLHKKLLEKNDIYKQKKISELFVLEGKRQ IVMAQASENSLSLCTP

DMEDIGLTKPHHSTVPVATKRKRVWETQKESQDIALTVPWQEVLGQPPSLGTTQ EEWLVWLQFHKKKWQLQAQQRLALRKKQRLESAEDMPRLGPIREG

PSTGLGSFLRRTARSIMDLPWQIIQ ISETRQAGLFRLWAIIGNDLHCIKLSIPRVFYVNQRVAKAEDGPAYRK - UNI31957 - VNRALPRSNIVY

NLYEYSVPEDMYQEHINEINTELSVPDIEGVYETQ VPLLFRALVQLGCVCVVNKQLTRHLSGWEAETFALEHLEMRSLAQFSYLEPG GSIRHIYLYHH

TQGHKALFGVFIPSQRRASVFVLDT VRSNQMPGLSALYSSEHSLLLDKVDPKLLPPPKHTFEVRAETNLKTICRAIQRFLLAYK EERRGPTLIAVQSS

WELCRLTSEIPVLEEFPLVPIRVADKISYAVLDWQRHGARRMIRHYLNLDLCLSQAFEMSR RYFHIPVGNLPEDISTFGSDLFFARHLQHHNHLLWLSP

TSRPDLGGKEADDNRLVMEFDDRATVEINSSGCYSTV VCVELDIQNLAVNTILQSHHVNDMEGAGSMGISFDVIQQASLEDMVTGNQAASALANYDETA

LCSSTFR RILKSMVVGWVKEITQYHNIYADNQVMHFYRWLQSPCSLLHDPALHRTLHNMMKKLFLQ QLIAEFKRLGSSVVYANFNRIILCTKKRRIED

ALAYVEYITNS SIHSKEIFHSLTISFSRCWEFLLWMDPSNYGGIKGKVPSSIHCGQVKE - UNI9059 - QDSQAREETDEEEEDKEKDEEEEGMGE

SEVEDLLENNWNILQFLPQAASCQSYFLMIVSA AYIVAVYQSMKEELRHSAPGSTPVKRKGASQFSQESEGATGSLPG GMITFSQDYVANELTQSFFT

ITQKIQKKVTGSRNTTEPSEMFPVLPGSHLLLNNPALEFIKYVCK VLSLDTNITNQVNKLNRDLLRLVDVGEFSEEAQFRDPCHSYVLPEVICHSCNFC

RDLDLCKDSSFSQ DGAILPQWLCSNCQAPYDSSAIESALVEALQRKLMAFTLQDL VCLKCRGMKETHMPVYCSCAGDFTLTIRTE VFMEQIRIFQNI

AKYYSMSYLQETIEWLLQTSPVSNC

For any suggestions or comments, please send an email to unitrap@crg.es