Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000007379 (Dennd2c)
Chromosomal location
Chr 3: 102931479 - 102973654 (+)
Description
DENN/MADD domain containing 2C Gene [Source:MGI Symbol;Acc:MGI:3036254]
RefSeq_dna
NM_177857 
RefSeq_peptide
NP_808525.1 
UniGene
Mm.293641 
MGI
MGI:3036254 
Uniprot/SWISSPROT
Q6P9P8 
Uniprot/SPTREMBL
Q6NZD6 Q8C8V8 
Human Ortholog
ENSG00000175984 (DENND2C)
Omim not available
UniTrap UNI14457
Vector Insertion
Chr 3: 102931574 - 102935275
Public Clones (sanger) E037B07 (ggtc) D113H06 (ggtc) E120F06 (ggtc) D146H03 (ggtc)
D030B01 (ggtc) E068C05 (ggtc) D146G06 (ggtc) D029F05 (ggtc) D153B09 (ggtc)
D110D01 (ggtc) 5SE286A01 (ggtc) E053E11 (ggtc) D131H10 (ggtc) D025C06 (ggtc)
D108D11 (ggtc) FHCRC-GT-S12-11C1 (fhcrc) IST10938E10HMF1 (tigm) IST12178B12 (tigm)
IST13052H3 (tigm) IST14626B4 (tigm) IST14613C11 (tigm) IST12561A5 (tigm)
IST10947C7 (tigm) IST12175H8HMR1 (tigm) IST14670D12 (tigm) IST13062G9 (tigm)
IST12127H12 (tigm) IST14195A9 (tigm) IST14312A5 (tigm) IST14730H2 (tigm)
IST13056H8 (tigm) IST14149F2 (tigm) IST14626G3 (tigm)
Private Clones OST448956 (lexicon) OST440727 (lexicon) OST347479 (lexicon) OST339572 (lexicon)
OST303192 (lexicon) OST300507 (lexicon) OST290742 (lexicon) OST280682 (lexicon)
OST278534 (lexicon) OST237901 (lexicon) OST230851 (lexicon) OST214611 (lexicon)
OST208992 (lexicon) OST207700 (lexicon) OST201591 (lexicon) OST168903 (lexicon)
OST168723 (lexicon) OST147337 (lexicon) OST139590 (lexicon) OST132470 (lexicon)
OST106538 (lexicon) OST66304 (lexicon) OST53651 (lexicon) OST43401 (lexicon)
OST41518 (lexicon) OST41085 (lexicon) OST40362 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25968
Vector Insertion
Chr 3: 102937775 - 102941065
Public Clones IST14888H6 (tigm)
Private Clones OST148950 (lexicon)
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26449
Vector Insertion
Chr 3: 102941237 - 102944981
Public Clones IST13696G4 (tigm) IST11619H3 (tigm) IST14442C3 (tigm) IST14384G6 (tigm)
Private Clones OST117525 (lexicon) OST41089 (lexicon)
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30930
Vector Insertion
Chr 3: 102945079 - 102950434
Public Clones IST12585F1 (tigm) IST13848D12 (tigm) IST10097B1 (tigm) IST14261F9 (tigm)
IST12613E12 (tigm) IST12754A9 (tigm) IST12807B2 (tigm) IST10471D3 (tigm)
IST10186D2 (tigm) IST10398B3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12637
Vector Insertion
Chr 3: 102950480 - 102952963
Public Clones (sanger) A017B06 (ggtc) CMHD-GT_536C5-5S (cmhd) IST10750F1 (tigm)
IST11850H1 (tigm) IST14375G11 (tigm)
Private Clones OST123605 (lexicon)
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8320
Vector Insertion
Chr 3: 102953146 - 102956215
Public Clones RRF395 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33132
Vector Insertion
Chr 3: 102956326 - 102957559
Public Clones IST10459G6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4131
Vector Insertion
Chr 3: 102958489 - 102959962
Public Clones AN0296 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3311
Vector Insertion
Chr 3: 102961745 - 102965470
Public Clones AD0315 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12338
Vector Insertion
Chr 3: 102970423 - 102971693
Public Clones W094B07 (ggtc)
Private Clones OST288728 (lexicon)
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000007523
Sequence
GTCTTGTGCCTGGTGTGTAATATCTGAAATCGTTTGTCTTCTGTATAGTTTTGTAGCTGCATCAGCAAGGCAAGTCTACTCTATCATGGCTACGG - UN

I14457 - GATCATTCATGATACAGTTGTAGCTGTTTTCAACAAAGCTCGGTGATGAAAACTGTTATTTTTAACAAGATACCTCCAAGTTAAACATGAA

ACGAAAACACTTGGATCGTTTCCGTTCTGGCAAGGCAAAGAATACAGCGTTTTCCAGCTAACTGGTCATGGCACCTCTCTAAGAGTGACTCGTCATGCAC

CCCACCGGGAACATGGATGTTGGCTTTACACGGTCTGCTGTTCAGACCTTGTCCAGGAGCCACTGCAAAAACATCAAACAGAAGATTTCCCAGTGGGAAG

GAAGAGCTAACGGTGTAACCAAGACAGCTAAGTTTCACCCAAAGGACTTTGGAGTGAGGTATAACTGCCACCAAGAGAGTCCCCCTCATAAGCGTCCCAC

TGGTGAGGAAAGGAATGGGGCTTTACCCAGAAACACGGATGTCAAAAGCCGAGATCAAAGTGAGGATGAAGGCGAGGGTGGAGAGTGTAGAGGCTCCCAC

CCCTCGGAAGCTGGACTGGACTCCAGCCTGGTGTGTGCTCGGGTCAAACAAATCGAAGGCTGCCAAGCTGTTGCTGTGGGTCCAGAGGCTTCCTTACCGC

CAGGAAACTTCTACACCTCCCAGATACCGTGGAGAAGCATAGACGGGCTCTCCCCAGATAAACCCTTAAATTTGGCCTTAGCACCTTGTAACTCTACAGG

GAGAGAACCGGATCTCAGTGTTCTGGATAGTTCTTACGGAATAACCAAGAGCTTGGAAAATATTTATTATGAACCTGAGGGGCAGGAATGTGGCCCCTCT

ATAAATCCTTTACCCAAACCCCGTAGGACATTCAGGTATTTATCTGAATCTGATGGTATACCATATAAAGAAAGGAACTGTGATCAAAAGTACTGTGAAA

GTATTTCCTGTGTGGACCCTTCTTTGGCCTCTTCTCAGGATCCCGAACCAAAGAAATATGGCGGGAAGATCAGAGGGCGGTCCAAAAG GAAATCCTTTG

AATTTGAAGATATCCAGCACTTTCGGAACTCACGAAAGATCCATGAAGAACTTGGAAGAAATGCTGGCTCAGCACTTTACTACACACAGTCCGAGGATAA

TATCTATGAGGATATTATAT ATCCAGCCAAGGAAAATCCATACGAAGATATCCCAGTGCAGTCGTTCCCTGTTTGGAGATCCCCTTCAGCGTGGAGGCT

GCCACCTGCTAAGAGCGCCTTCCGAACACCCAAG - UNI25968 - CTTCCTCCCAAACCCCAGTTCTTTCAGCGGAAGACTATGGAACTGAAGAATT

CTCAAGCATATTTTCGATCAAAAATCACAAAGGATACTACTTTGCCTGTCACCCTAACGGAATGGAAACTGTTCCGAGCTGGAGAGGTGGCTAACAAGAA

GAAGAGAAATCTCCCACCG - UNI26449 - CTTGTTTTGAAAATAAATGATACATTTGAATCTAAGAGAGGGAAGAAGAGGGTAAAGTTACAGCCTT

ACACTGGAAAGGAAGCCCCCTCCTCAAAAG - UNI30930 - GTGAAACCAGTGGGAACGAGAGCGATGCCGAGTACCTGCCAAAGA - UNI12637

 - ATCGCCACAAGCGCTTGGCACAGCTGCAGCCGTCCTCCAAGAGGAACCCCCACTACCAGACCTTGGAGCGCGACCTCATTGAGCTACAGGAGCAGCA

GCTCTTTGAACTCTTCGTGGTGGTTTCTCTGCAGAAGAAGCCGGCAGGGTACACTCCCCAGGTCATACAGCAGTTCCCTAGCAAG - UNI8320 - GG

TGACCATGGCTACAAGCAGTCCAAAGACACTGAGGAAAGGCTCAAAGTCATCCCCAGGTTTTGTTTTCCTGATTCAGAGGACAGCGCACCAACCTTAGAA

CTCAAGAG - UNI33132 - TGAAACCTTCTCCTTCGTGCTGACTGGAGAAGATGGAAGCCGGTGGTTTGGCTACTGTAAGAAGCTTTTG CCAGAAG

GCAGGGGAAAGCGGCTCCCTGAGGTGTACTGCATGGTTAGTCGCTTGGGCTGCTTCAATCTTTTCTCAAAG - UNI4131 - ATCCTGGATGAAGTAG

AGAAGAGGAGAGAGATGTCTCCAGCCCTTGTGTACCCATTCATGCGAAGTGTCATGGAAGCCCCTTTCCCAGCTCCTGGCCGCACCATCACAGTTAAGAG

CTACCTCCCTGGGGCTGGAGATGAG TCAATTGAACTCTGCCGACCACTCGATTCACGCCTGGAACATGTGGACTTTGAATGCCTTTTCAAATGCTTGAG

TGTGCGTCATCTCATCCGGGTCTGTGCCTCTCTCCTTCTCGAGCGGAGGGTAATCTTTGTTGCTAACAGCTTAAG CACCCTTTCAAAATGCGGCCATGC

TGTGGTAGCTACACTGTATCCGTTCACCTGGCAGCACACCTACATCCCAGTGCTGCCAGTGTCCATGATTGACATAGTGTGCTCACCTACTCCGTTCTTT

ATCGGGATCTTGTCTTGTTCCTTACCCCACCTCCAGGACCTTCCGATTGAGGAG - UNI3311 - GTGCTGATAGTTGATCTCTGTGCAGACAGGTTC

CTACAGGAG GTGTCTGATGAGGATGAAATTCTGCCACCTAAACTTCAAGCAGCCTTGGTGCAGATTTTAGAAGATCGAGATGAAGTCTTGGCTCAGGAA

CAGCAGTTTTCACAAG AGGTGACACTCAGTTCTCTGGTGTCGGAAGCGTTCGTCAGGTTTTTTGTGGAGCTCGTGGGGCATTATTCTCTGAACATGACT

GTCACAGAGCGTGGGGAGCGTGTGTTCCAAAGGGAGCCATTCCGGAAGTCCCACACTTCCCGAAGTGTCCGCCACTTCCTAGATCTCTTCATGGAGACAC

AGATGTTTGCAGGATTTGTCCAGGACCGGGAGCTTCGGCAAAGCGGAGTTAAAG GTTTGTTTGAAGTCCGGGCTCTTCAATATTTGGAAACAATTCCTG

AGTCGGAACCCAGCGGGGTGAATAGAATTTTACGTAGTCTTG - UNI12338 - GAAGTAAAATGAAATTTCTTCACAAGAAGTGAAATCTTTTCTTC

ATTCTAAACATAGCTGGAAGTGCCAACGACAGTGTTTTCCCAAGGATCTGGATGCTCGGGAGAGTCCTGTAACATCTGTGACTGTAAAAGGAGAAAGACT

GTTGGAAAACTCTCCTGTTGCTGCAGACCAACTGGGAGCAGTCTAGAACCAGTGCGCTCTCTTCTCCTTCTGATTTGGGGACTGTTTTGTTTGTTTGTTG

TTTTTGAGACAGGGTCTCTCGCTATAGCCCTGACTGTGATGGAACTCGTTCTGTAGATCGGGCTGGCCTCAAATCCTGATGTCACAAATCTCAAAGATCT

CACAGAGGTCCTCCTGCCTCTGCCTCCCAAGTGCTGAGATCAAAGGCGTGCACCGCCATGCCTGGGCTCGTTATTTTACAGTGGTGTTTTATCTTTGGTT

ACTGATGGGTGCAAGAGCCTCTGCTTTGTGCTTGTGGTTGTCCTTTACAAGGAGAAGACTCAGAAATACTTGGTGTTGAGTTCCTAAAAACAATGCAAAG

ATGAGATTGACAGAGAAATAAGGAGAATAATGAGAGTTTCAGGTACTAGGGAGACAGACATGGAGGACACCATGGTCACACGATTCTCATCACTGAAGCA

TCATATTGCTTTAAATACGTGGACGGTTTGTGCTTTCTAATTCCAGTACTGTCACCATTGATTAAACCCCCCTTTTGTCCCATGTCCTATCTTGGAGAAT

TTCACTCATGTTAGAACTTTAAAAAAAAAGCAGACACCAGGCATGGCCTCCTCAGAACACGTGTCCTGCTGGGATAGCTTGCTTCTCATATGTCAGCATT

ATGCTTTATGGAATGGAGCCAACATTAAAATGTCCTTTTAAGGACATAGCTATCTGAGTTTTGGTGTTTACAATTTGCAGCACTGTGATAATCTACATGT

CATCTTATTCAAGCTTTAGATCAGCTTCATGATATTCTACAAGAAACTGGAGTTCAGAGAAGCTAAGGAATTTGGCCAGTTATATACAAGAAAGAACTAA

GCCAAACACTTGACTTATGAACACATACAAAGCTGGTTAGTCCTACAGCTGTAAATGAACTCTTTATAGTGATGTTTAAAGTTCTCTGTGGAGCACACCA

GAGCTTCCTTTTTGGCTCTGATGAGACGTTAAGCTATGGGGGTCTAGACAAGGTTTGTTCCTTTGTTTCTTCTTCTGCTGCTGGGGATAGGACCCAGGGC

CTTTTGTGTGCTCTGCCACACTGGTTATTTTTACATCGGTGTGAGTTTTTAGTGTTTCCTAAGCCTCTTCATCAACCAGATGCTGAAAATCTAAAGTAGG

AGTAGCACCTGGGAAAGGGAGTTTGTCAGTGAGGGTACAGTTTTCATTGATAAGTGAGAAATGTTGTGGTAAATGTCAGTTGTTTTCTGTAACCTTTGCC

CACTGCTTTACCTGGCATGGAAAATACTCATTCAGACTTGGAAAGTGTTGTTTGTTGTACTGGGATACAACTCACTGACTTGTATAGTATTGTCATTGTC

ACTCATACTAGGGTGTCTGAATGAATCCATTTAAGACTGGTGCTGTGCAATATAGTTCCCACACATGGGTCCAGGGAAGAGAACTGAGTCTGTCCTTTCA

AATGTTAGTGCAGCTCACCCAGGGGAGCTCCTCCCAGACAGCTCTCTCCTTTCCTTCTTCCTACACTCCAATCCCGATGGAACAATTCATGACTGGTTGT

TTATAAGATGGGGAAGGAGGGTTTACTGTGGTCAATCATGACTGTCCCTCTGCAGGGAGACTGCTTTTGGGAGAGTCTTAACCTTCTTAAGATCTAAAGC

TGCTTCCTTTCCTTGAGTTTGTTGTAATTTGTTTTTGTAAATGTTGTGAATTCTAAATACGTTTGTAAAAAGAATTGTTCAATATTTCTATCAAATGTTT

ACAGATAAAGGCATTTT
Translation
 - UNI14457 - MDVGFTRSAVQTLSRSHCKNIKQKISQWEGRANGVTKTAKFHPKDFGVRYNCHQESPPHKRPTGEERNGALPRNTDVKSRDQSEDE

GEGGECRGSHPSEAGLDSSLVCARVKQIEGCQAVAVGPEASLPPGNFYTSQIPWRSIDGLSPDKPLNLALAPCNSTGREPDLSVLDSSYGITKSLENIYY

EPEGQECGPSINPLPKPRRTFRYLSESDGIPYKERNCDQKYCESISCVDPSLASSQDPEPKKYGGKIRGRSKR RKSFEFEDIQHFRNSRKIHEELGRNA

GSALYYTQSEDNIYEDIIY YPAKENPYEDIPVQSFPVWRSPSAWRLPPAKSAFRTPK - UNI25968 - LPPKPQFFQRKTMELKNSQAYFRSKITK

DTTLPVTLTEWKLFRAGEVANKKKRNLPP - UNI26449 - LVLKINDTFESKRGKKRVKLQPYTGKEAPSSKG - UNI30930 - GETSGNESDA

EYLPKN - UNI12637 - NRHKRLAQLQPSSKRNPHYQTLERDLIELQEQQLFELFVVVSLQKKPAGYTPQVIQQFPSK - UNI8320 - GDHGYK

QSKDTEERLKVIPRFCFPDSEDSAPTLELKS - UNI33132 - SETFSFVLTGEDGSRWFGYCKKLL PEGRGKRLPEVYCMVSRLGCFNLFSK - U

NI4131 - ILDEVEKRREMSPALVYPFMRSVMEAPFPAPGRTITVKSYLPGAGDE SIELCRPLDSRLEHVDFECLFKCLSVRHLIRVCASLLLERRVI

FVANSLS STLSKCGHAVVATLYPFTWQHTYIPVLPVSMIDIVCSPTPFFIGILSCSLPHLQDLPIEE - UNI3311 - VLIVDLCADRFLQE VSDE

DEILPPKLQAALVQILEDRDEVLAQEQQFSQE EVTLSSLVSEAFVRFFVELVGHYSLNMTVTERGERVFQREPFRKSHTSRSVRHFLDLFMETQMFAGF

VQDRELRQSGVKG GLFEVRALQYLETIPESEPSGVNRILRSLG - UNI12338 - GSKMKFLHKK

For any suggestions or comments, please send an email to unitrap@crg.es