Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000007564 (Ppp2r1a)
Chromosomal location
Chr 17: 21082459 - 21102864 (+)
Description
protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform Gene [Source:MGI (curated);Acc:Ppp2r1a-001]
RefSeq_dna
NM_016891 
RefSeq_peptide
NP_058587.1 
UniGene
Mm.294138 Mm.473300 
MGI
MGI:1926334 
Uniprot/SWISSPROT
Q76MZ3 
Uniprot/SPTREMBL
Q7TMX2 Q8C2E1 
Human Ortholog
ENSG00000105568 (PPP2R1A)
Omim not available
UniTrap UNI4777
Vector Insertion
Chr 17: 21082548 - 21088306
Public Clones AW0556 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28248
Vector Insertion
Chr 17: 21102295 - 21102418
Public Clones not available
Private Clones OST36060 (lexicon)
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000007708
Sequence
AGGGAGCCAAGATGGCAGCTGCCGACGGTGACGATTCGCTCTATCCTATTGCGGTGCTCATAGATGAACTCCGCAATGAGGACGTTCAG - UNI4777 

- CTTCGTCTCAATAGTATCAAGAAGCTCTCCACAATTGCCTTGGCCCTTGGGGTTGAACGGACCAGAAGTGAGCTCCTGCCCTTCCTTACAG ATACCA

TTTATGATGAAGATGAGGTCCTCTTGGCCTTGGCTGAACAGCTGGGAACCTTCACAACTTTGGTGGGAGGGCCTGAGTATGTGCACTGTCTGCTG CCAC

CCCTTGAGTCACTGGCCACAGTGGAAGAGACAGTAGTGCGAGACAAGGCGGTAGAATCCTTGCGGGCCATCTCTCATGAGCACTCACCTTCCGATCTAGA

GGCTCACTTTGTGCCTCTGGTAAAGCGGCTGGCGGGTGGAGACTGGTTCACCTCCCGCACCTCGGCCTGTGGTCTCTTCTCAGTTTGCTACCCCCGAGTA

TCCAGTGCCGTGAAGGCAGAACTTCGACA GTACTTCCGGAACCTGTGCTCAGATGACACCCCCATGGTGCGGCGGGCCGCTGCCTCCAAGCTGGGGGAA

TTTGCCAAGGTACTGGAGCTGGACAATGTCAAGAGTGAGATCATTCCCATGTTCTCTAACCTGGCCTCTGACGAGCAG GACTCGGTGCGGCTGCTGGCA

GTGGAGGCATGTGTGAATATTGCCCAGCTTCTGCCACAGGAGGACCTGGAGGCCTTAGTGATGCCCACCTTGCGACAGGCTGCTGAGGACAAGTCTTGGC

GTGTTCGCTACATGGTGGCCGACAAGTTCACAGAG CTCCAGAAAGCAGTGGGGCCTGAGATCACCAAGACAGATCTGGTGCCTGCCTTCCAGAACCTGA

TGAAGGACTGTGAGGCCGAGGTGAGGGCCGCAGCCTCCCACAAGGTCAAAG AGTTCTGTGAAAATCTCTCAGCTGACTGCCGGGAGAATGTGATCATGA

CTCAGATCTTGCCCTGCATCAAG GAGCTTGTGTCAGATGCCAACCAACATGTCAAGTCAGCACTGGCTTCAGTCATCATGGGCCTCTCTCCCATTCTGG

GCAAAGACAACACCATCGAACACCTCTTGCCCCTGTTCTTGGCTCAGCTGAAGGATGAG TGTCCTGAAGTCCGACTGAATATCATCTCCAACCTGGATT

GTGTGAACGAGGTGATTGGCATCAGGCAGCTCTCTCAGTCCCTGCTTCCTGCCATCGTGGAACTAGCTGAAGATGCCAAGTGGCGAGTGCGGCTGGCCAT

CATTGAATACATGCCTCTGCTGGCTGGACAGCTT GGTGTGGAATTTTTTGATGAGAAACTAAACTCTTTGTGTATGGCCTGGCTAGTGGATCATG TCT

ATGCTATCCGTGAGGCTGCCACCAGCAACCTTAAGAAATTAGTAGAGAAGTTCGGGAAGGAGTGGGCCCATGCCACTATCATCCCCAAGGTCTTAGCCAT

GTCTGGAGACCCTAACTACCTGCACCGAATGACTACACTCTTCTGCATCAAT GTGTTGTCTGAGGTCTGTGGACAGGATATCACCACCAAGCACATGCT

GCCCACAGTTCTTCGTATGGCAGGGGACCCAGTTGCCAATGTCCGCTTCAATGTGGCCAAGTCACTCCAGAAGATAGGACCCATTCTTGATAACAG CAC

CCTGCAGAGTGAAGTCAAGCCCATCCTGGAGAAGCTGACCCAGGACCAGGATGTGGATGTCAAGTACTTTGCCCAGGAGGCTCTGACTG - UNI28248

 - TTCTCTCTCTTGCCTGATGCTGGAAGAAGAAGCATTGCCGGCCTCTGGTGTCCACCCTCCAACCCCCACAAAGTTACCTCCCTTAGGGAGGTGGTGG

GGGCAAATGACTGTCACTCCCTGTGCATGGTCTGACCCCAGGCTCCTCCCCCAGCACGGTTCGGTTCCTCCTCTGTAGCCTGGGAAGACTTCTCTGTCCA

CCTCCCAAGGGGCTGGAGCAGTACAAGTTGTTGCAGGACAGCAGCCTGAAAAGAAGGGCTGGTTGTTCCTGCCCATATTGGGAGAGATGGGAGCATCCTA

GGTCACTGGCTTTTGCTGCTGTAATGGGGACCCCTCCCCCATCTACTTACCACCACCCTTTCCCAACCCCAACCATGTTTTTTGTGTGTCAATTGTGCCA

TTTTTATTTTATTCCTTTCCCTACTGTACACGGAGAAATAAAGGTGTAG
Translation
MAAADGDDSLYPIAVLIDELRNEDVQ - UNI4777 - LRLNSIKKLSTIALALGVERTRSELLPFLTD DTIYDEDEVLLALAEQLGTFTTLVGGPEY

VHCLL PPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQ QYFRNLCSDDTPMVR

RAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQ DSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTE LQKAVGPEITK

TDLVPAFQNLMKDCEAEVRAAASHKVKE EFCENLSADCRENVIMTQILPCIK ELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDE 

CPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQL GVEFFDEKLNSLCMAWLVDHV VYAIREAATSNLKKLVEKF

GKEWAHATIIPKVLAMSGDPNYLHRMTTLFCIN VLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNS STLQSEVKPILEKLTQD

QDVDVKYFAQEALTV - UNI28248 - VLSLA

For any suggestions or comments, please send an email to unitrap@crg.es