Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000007570 (Fance)
Chromosomal location
Chr 17: 28450475 - 28463512 (+)
Description
Fanconi anemia, complementation group E Gene [Source:MGI (curated);Acc:Fance-001]
MGI
MGI:1920025 
Uniprot/SPTREMBL
Q8R3Z2 Q3UY28 
Human Ortholog
ENSG00000112039 (FANCE)
Omim 227650 - FANCONI ANEMIA  600901 - FANCONI ANEMIA, COMPLEMENTATION GROUP E  
UniTrap UNI31140
Vector Insertion
Chr 17: 28455353 - 28457734
Public Clones IST14192H10 (tigm) IST12524B12 (tigm) IST10313G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34479
Vector Insertion
Chr 17: 28459717 - 28463096
Public Clones IST11595G5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114801
Sequence
TGGCTTCGGGAGCTTTGCGCGGCTGGAGTGGCGCTCCGATCCCGCGTGTCCTAGCCGCCGCCCCGCGTCCGCTCTGCGCTGGCGACGCCGGGGTCGGACT

CCGTAGCCTCGGCCGGAGCGGCGCCCTGGGCGAGCCTGGAGGCCCCTGCCCGCCTCCTGCTTCAGGCGCTACAGGCAGGGCCTGAGGGTGCGCGGCGCGG

GCTAGGGGTTCTGCGCGCCCTCGGCCGCCGCGCGGAGCACTTCCCTTGGGATGGCTTCCTGGAGGCGCTGGGCCACTTAGAGCCCGAGGTGCGGGGCCCC

GACGGCCGCCTAGAGCT GGTCCCACTGTTGCTCCGGCTGCCTGGGGTCTGCCAGAAGAACCTGCTGTCCCTGCTGCTGGCTCTCCTACCATCCTTACCT

GAAAGCGGACTCCGCTCTGTGCTGCAGCTCCACCATCAGGATGTGTCCTCTACCACTGATGCCTGGCTCCATGCCCTGGGGGAGCTGCTGCGAAGGGATG

TGGGGGTTGGAGTCGCTGAGGGATCTTCTCCATTGACCAGAAGCTGTCAGTTACAGCTCCGGGACCTGTGTGGGCGGCTGGGCCAAGGGGGGAGGGGGCT

GAAACTGGCCCTGGCTCCAGATCCTGAACAAGAGGACAGACTCTCACAGCTTTGCGGGAAACGGACGAAAGAGCCAGAAGAGGCTGCCAGCCCTGAGTCA

GAGAGATCCCCTAAAAGGTTCCGGGGCTGTGAGGAGGCGGTGGAAGGAAAGGAACCGGAGGAGAGACCCACGCTGGAGTCGCTGGGATCCCCACCAGATG

CAGGAGGCGTGTTGCCTGACACTGACGCCCAGGCTCCGGAGACTGGCCCTGGCGTGGAGGGTCCCAAGGGTCCCGCTGAGAGTGTGGAGTTGCCCAAAGT

TGTCCAG GACCAGGTGCCCAGGCTGCAGCTGCTGCTGAAGGCCTTCCAGGAG ATGGAGTTGCTATGCAGCGAACTACAGCTACCCCAGCTCCCTGACG

GAGGTCTCCTGCAGCTCTGCAGCCACCTGATGGGTCTCACACCAGCCCTCAGCCTCAGCAATGCCTCTGTGCTGGCCAGGAGCCTCTTTCTTGACCGG G

CTTCTCAGAGTGGCCCTCGTCTCCTTCTGTGTAAAGTACACCTACGCCATCTGCAGGGCTGTCCTCTGTCCCTTGCTCCAGGACCCTCGTGTAG GTCCT

GCGCAGACCGAGTTACTGTGTTCCCTCATAAAGGATGAGTCCCTGGAGTCAGACATGCAGGTCCAGATTTTGGG - UNI31140 - GCAGGTCCTGGA

GCTGGCCTGGCGAGAAGAGACGTTCCTGGTGTTGCAGACGCTCCTGGAACGGCAG ATCACAGAGCAGCAGAGCCTGGACCTGGCTGTGGCCCTAGAGCC

CAACGCCACCTTCCTGAAGAAGGCCCTGCAAGCAGCGCTGAGACATGTGACCCACTGACCATACACAAGGACACACCGCCCTGACTGCTTGTCTCAGAAC

ACACAGCCATCTCAGGAGTCAGCTGCCTCTGCCCAACACCCCAGGCTCTGCAGGGGCCATATTGACTCCACAAGGAGCAGAGAGGAGGCCTTGGGTACCA

CTCCTGACAACATCAGGATACAGGGGCTGTGGAGGATGAGTGGGAGGTGGGCAGAAAAGCTGGCCTTTCAGTGTGAGCCTTTTGTGCTCAGGTATATGTT

GTGACCTCCTCTGTTTTGTTTGTTTCTGAACTGAGTAATTTTGTAACAGTTTTAATAAAAAGAAGACAGTC
Translation
   MPLCWPGASFLTG GLLRVALVSFCVKYTYAICRAVLCPLLQDPRVG GPAQTELLCSLIKDESLESDMQVQILG - UNI31140 - GQVLELAW

REETFLVLQTLLERQ ITEQQSLDLAVALEPNATFLKKALQAALRHVTH
Transcript ENSMUST00000114803
Sequence
GCCCCTTCAGGCTCTACAGGGTGCTCCGGCTTTCCTTGGCTTCGGGAGCTTTGCGCGGCTGGAGTGGCGCTCCGATCCCGCGTGTCCTAGCCGCCGCCCC

GCGTCCGCTCTGCGCTGGCGACGCCGGGGTCGGACTCCGTAGCCTCGGCCGGAGCGGCGCCCTGGGCGAGCCTGGAGGCCCCTGCCCGCCTCCTGCTTCA

GGCGCTACAGGCAGGGCCTGAGGGTGCGCGGCGCGGGCTAGGGGTTCTGCGCGCCCTCGGCCGCCGCGCGGAGCACTTCCCTTGGGATGGCTTCCTGGAG

GCGCTGGGCCACTTAGAGCCCGAGGTGCGGGGCCCCGACGGCCGCCTAGAGCT GGTCCCACTGTTGCTCCGGCTGCCTGGGGTCTGCCAGAAGAACCTG

CTGTCCCTGCTGCTGGCTCTCCTACCATCCTTACCTGAAAGCGGACTCCGCTCTGTGCTGCAGCTCCACCATCAGGATGTGTCCTCTACCACTGATGCCT

GGCTCCATGCCCTGGGGGAGCTGCTGCGAAGGGATGTGGGGGTTGGAGTCGCTGAGGGATCTTCTCCATTGACCAGAAGCTGTCAGTTACAGCTCCGGGA

CCTGTGTGGGCGGCTGGGCCAAGGGGGGAGGGGGCTGAAACTGGCCCTGGCTCCAGATCCTGAACAAGAGGACAGACTCTCACAGCTTTGCGGGAAACGG

ACGAAAGAGCCAGAAGAGGCTGCCAGCCCTGAGTCAGAGAGATCCCCTAAAAGGTTCCGGGGCTGTGAGGAGGCGGTGGAAGGAAAGGAACCGGAGGAGA

GACCCACGCTGGAGTCGCTGGGATCCCCACCAGATGCAGGAGGCGTGTTGCCTGACACTGACGCCCAGGCTCCGGAGACTGGCCCTGGCGTGGAGGGTCC

CAAGGGTCCCGCTGAGAGTGTGGAGTTGCCCAAAGTTGTCCAG GACCAGGTGCCCAGGCTGCAGCTGCTGCTGAAGGCCTTCCAGGAG GGGCTGGAGG

GTCAGGAGAAGCCCCTAGTGGACCTGCAGTTTCTTCATGAATGTAGTCCCAGCGAG ATGGAGTTGCTATGCAGCGAACTACAGCTACCCCAGCTCCCTG

ACGGAGGTCTCCTGCAGCTCTGCAGCCACCTGATGGGTCTCACACCAGCCCTCAGCCTCAGCAATGCCTCTGTGCTGGCCAGGAGCCTCTTTCTTGACCG

G GCTTCTCAGAGTGGCCCTCGTCTCCTTCTGTGTAAAGTACACCTACGCCATCTGCAGGGCTGTCCTCTGTCCCTTGCTCCAGGACCCTCGTGTAG GT

CCTGCGCAGACCGAGTTACTGTGTTCCCTCATAAAGGATGAGTCCCTGGAGTCAGACATGCAGGTCCAGATTTTGGG - UNI31140 - GCAGGTCCT

GGAGCTGGCCTGGCGAGAAGAGACGTTCCTGGTGTTGCAGACGCTCCTGGAACGGCAG GTAGAGATGACCCCTGAGGTGTTCAGTGTCTTAGTGCAGAG

GCTCTGCAAAGAGGGACCAGCAGCCACTACCTCCATGGCCTATGCCAAGCTGATGCTGACGGTGATGACCAAGTACCAGACCAGT ATCACAGAGCAGCA

GAGCCTGGACCTGGCTGTGGCCCTAGAGCCCAACGCCACCTTCCTGAAGAAGGCCCTGCAAGCAGCGCTGAGACATGTGACCCACTGACCATACACAAGG

ACACACCGCCCTGACTGCTTGTCTCAGAACACACAGCCATCTCAGGAGTCAGCTGCCTCTGCCCAACACCCCAGGCTCTGCAGGGGCCATATTGACTCCA

CAAGGAGCAGAGAGGAGGCCTTGGGTACCACTCCTGACAACATCAGGATACAGGGGCTGTGGAGGATGAGTGGGAGGTGGGCAGAAAAGCTGGCCTTTCA

GTGTGAGCCTTTTGTGCTCAGGTATATGTTGTGACCTCCTCTGTTTTGTTTGTTTCTGAACTGAGTAATTTTGTAACAGTTTTAATAAAAAGAAGACAGT

CC
Translation
    MPLCWPGASFLTG GLLRVALVSFCVKYTYAICRAVLCPLLQDPRVG GPAQTELLCSLIKDESLESDMQVQILG - UNI31140 - GQVLELA

WREETFLVLQTLLERQ VEMTPEVFSVLVQRLCKEGPAATTSMAYAKLMLTVMTKYQTS ITEQQSLDLAVALEPNATFLKKALQAALRHVTH
Transcript ENSMUST00000088007
Sequence
CTGGCGACGCCGGGGTCGGACTCCGTAGCCTCGGCCGGAGCGGCGCCCTGGGCGAGCCTGGAGGCCCCTGCCCGCCTCCTGCTTCAGGCGCTACAGGCAG

GGCCTGAGGGTGCGCGGCGCGGGCTAGGGGTTCTGCGCGCCCTCGGCCGCCGCGCGGAGCACTTCCCTTGGGATGGCTTCCTGGAGGCGCTGGGCCACTT

AGAGCCCGAGGTGCGGGGCCCCGACGGCCGCCTAGAGCT GGTCCCACTGTTGCTCCGGCTGCCTGGGGTCTGCCAGAAGAACCTGCTGTCCCTGCTGCT

GGCTCTCCTACCATCCTTACCTGAAAGCGGACTCCGCTCTGTGCTGCAGCTCCACCATCAGGATGTGTCCTCTACCACTGATGCCTGGCTCCATGCCCTG

GGGGAGCTGCTGCGAAGGGATGTGGGGGTTGGAGTCGCTGAGGGATCTTCTCCATTGACCAGAAGCTGTCAGTTACAGCTCCGGGACCTGTGTGGGCGGC

TGGGCCAAGGGGGGAGGGGGCTGAAACTGGCCCTGGCTCCAGATCCTGAACAAGAGGACAGACTCTCACAGCTTTGCGGGAAACGGACGAAAGAGCCAGA

AGAGGCTGCCAGCCCTGAGTCAGAGAGATCCCCTAAAAGGTTCCGGGGCTGTGAGGAGGCGGTGGAAGGAAAGGAACCGGAGGAGAGACCCACGCTGGAG

TCGCTGGGATCCCCACCAGATGCAGGAGGCGTGTTGCCTGACACTGACGCCCAGGCTCCGGAGACTGGCCCTGGCGTGGAGGGTCCCAAGGGTCCCGCTG

AGAGTGTGGAGTTGCCCAAAGTTGTCCAG GACCAGGTGCCCAGGCTGCAGCTGCTGCTGAAGGCCTTCCAGGAG GGGCTGGAGGGTCAGGAGAAGCCC

CTAGTGGACCTGCAGTTTCTTCATGAATGTAGTCCCAGCGAG ATGGAGTTGCTATGCAGCGAACTACAGCTACCCCAGCTCCCTGACGGAGGTCTCCTG

CAGCTCTGCAGCCACCTGATGGGTCTCACACCAGCCCTCAGCCTCAGCAATGCCTCTGTGCTGGCCAGGAGCCTCTTTCTTGACCGG ATCCGCTCCCTG

CCGTCTTCTGCCTCCAGGCTTCTCAGAGTGGCCCTCGTCTCCTTCTGTGTAAAGTACACCTACGCCATCTGCAGGGCTGTCCTCTGTCCCTTGCTCCAGG

ACCCTCGTGTAG GTCCTGCGCAGACCGAGTTACTGTGTTCCCTCATAAAGGATGAGTCCCTGGAGTCAGACATGCAGGTCCAGATTTTGGG - UNI31

140 - GCAGGTCCTGGAGCTGGCCTGGCGAGAAGAGACGTTCCTGGTGTTGCAGACGCTCCTGGAACGGCAG GTAGAGATGACCCCTGAGGTGTTCAG

TGTCTTAGTGCAGAGGCTCTGCAAAGAGGGACCAGCAGCCACTACCTCCATGGCCTATGCCAAGCTGATGCTGACGGTGATGACCAAGTACCAGACCAGT

 ATCACAGAGCAGCAGAGCCTGGACCTGGCTGTGGCCCTAGAGCCCAACGCCACCTTCCTGAAGAAGGCCCTGCAAGCAGCGCTGAGACATGTGACCCAC

TGA
Translation
    MELLCSELQLPQLPDGGLLQLCSHLMGLTPALSLSNASVLARSLFLDR IRSLPSSASRLLRVALVSFCVKYTYAICRAVLCPLLQDPRVG GPAQ

TELLCSLIKDESLESDMQVQILG - UNI31140 - GQVLELAWREETFLVLQTLLERQ VEMTPEVFSVLVQRLCKEGPAATTSMAYAKLMLTVMTKY

QTS ITEQQSLDLAVALEPNATFLKKALQAALRHVTH
Transcript ENSMUST00000114804
Sequence
AGGGTGCTCCGGCTTTCCTTGGCTTCGGGAGCTTTGCGCGGCTGGAGTGGCGCTCCGATCCCGCGTGTCCTAGCCGCCGCCCCGCGTCCGCTCTGCGCTG

GCGACGCCGGGGTCGGACTCCGTAGCCTCGGCCGGAGCGGCGCCCTGGGCGAGCCTGGAGGCCCCTGCCCGCCTCCTGCTTCAGGCGCTACAGGCAGGGC

CTGAGGGTGCGCGGCGCGGGCTAGGGGTTCTGCGCGCCCTCGGCCGCCGCGCGGAGCACTTCCCTTGGGATGGCTTCCTGGAGGCGCTGGGCCACTTAGA

GCCCGAGGTGCGGGGCCCCGACGGCCGCCTAGAGCT GGTCCCACTGTTGCTCCGGCTGCCTGGGGTCTGCCAGAAGAACCTGCTGTCCCTGCTGCTGGC

TCTCCTACCATCCTTACCTGAAAGCGGACTCCGCTCTGTGCTGCAGCTCCACCATCAGGATGTGTCCTCTACCACTGATGCCTGGCTCCATGCCCTGGGG

GAGCTGCTGCGAAGGGATGTGGGGGTTGGAGTCGCTGAGGGATCTTCTCCATTGACCAGAAGCTGTCAGTTACAGCTCCGGGACCTGTGTGGGCGGCTGG

GCCAAGGGGGGAGGGGGCTGAAACTGGCCCTGGCTCCAGATCCTGAACAAGAGGACAGACTCTCACAGCTTTGCGGGAAACGGACGAAAGAGCCAGAAGA

GGCTGCCAGCCCTGAGTCAGAGAGATCCCCTAAAAGGTTCCGGGGCTGTGAGGAGGCGGTGGAAGGAAAGGAACCGGAGGAGAGACCCACGCTGGAGTCG

CTGGGATCCCCACCAGATGCAGGAGGCGTGTTGCCTGACACTGACGCCCAGGCTCCGGAGACTGGCCCTGGCGTGGAGGGTCCCAAGGGTCCCGCTGAGA

GTGTGGAGTTGCCCAAAGTTGTCCAG GACCAGGTGCCCAGGCTGCAGCTGCTGCTGAAGGCCTTCCAGGAG GGGCTGGAGGGTCAGGAGAAGCCCCTA

GTGGACCTGCAGTTTCTTCATGAATGTAGTCCCAGCGAG ATGGAGTTGCTATGCAGCGAACTACAGCTACCCCAGCTCCCTGACGGAGGTCTCCTGCAG

CTCTGCAGCCACCTGATGGGTCTCACACCAGCCCTCAGCCTCAGCAATGCCTCTGTGCTGGCCAGGAGCCTCTTTCTTGACCGG ATCCGCTCCCTGCCG

TCTTCTGCCTCCAGGCTTCTCAGAGTGGCCCTCGTCTCCTTCTGTGTAAAGTACACCTACGCCATCTGCAGGGCTGTCCTCTGTCCCTTGCTCCAGGACC

CTCGTGTAG GTCCTGCGCAGACCGAGTTACTGTGTTCCCTCATAAAGGATGAGTCCCTGGAGTCAGACATGCAGGTCCAGATTTTGGG - UNI31140

 - GCAGGTCCTGGAGCTGGCCTGGCGAGAAGAGACGTTCCTGGTGTTGCAGACGCTCCTGGAACGGCAG ATCACAGAGCAGCAGAGCCTGGACCTGGC

TGTGGCCCTAGAGCCCAACGCCACCTTCCTGAAGAAGGCCCTGCAAGCAGCGCTGAGACATGTGACCCACTGA
Translation
    MELLCSELQLPQLPDGGLLQLCSHLMGLTPALSLSNASVLARSLFLDR IRSLPSSASRLLRVALVSFCVKYTYAICRAVLCPLLQDPRVG GPAQ

TELLCSLIKDESLESDMQVQILG - UNI31140 - GQVLELAWREETFLVLQTLLERQ ITEQQSLDLAVALEPNATFLKKALQAALRHVTH
Transcript ENSMUST00000007714
Sequence
TCCTTGGCTTCGGGAGCTTTGCGCGGCTGGAGTGGCGCTCCGATCCCGCGTGTCCTAGCCGCCGCCCCGCGTCCGCTCTGCGCTGGCGACGCCGGGGTCG

GACTCCGTAGCCTCGGCCGGAGCGGCGCCCTGGGCGAGCCTGGAGGCCCCTGCCCGCCTCCTGCTTCAGGC GCGGAGCACTTCCCTTGGGATGGCTTCC

TGGAGGCGCTGGGCCACTTAGAGCCCGAGGTGCGGGGCCCCGACGGCCGCCTAGAGCT GGTCCCACTGTTGCTCCGGCTGCCTGGGGTCTGCCAGAAGA

ACCTGCTGTCCCTGCTGCTGGCTCTCCTACCATCCTTACCTGAAAGCGGACTCCGCTCTGTGCTGCAGCTCCACCATCAGGATGTGTCCTCTACCACTGA

TGCCTGGCTCCATGCCCTGGGGGAGCTGCTGCGAAGGGATGTGGGGGTTGGAGTCGCTGAGGGATCTTCTCCATTGACCAGAAGCTGTCAGTTACAGCTC

CGGGACCTGTGTGGGCGGCTGGGCCAAGGGGGGAGGGGGCTGAAACTGGCCCTGGCTCCAGATCCTGAACAAGAGGACAGACTCTCACAGCTTTGCGGGA

AACGGACGAAAGAGCCAGAAGAGGCTGCCAGCCCTGAGTCAGAGAGATCCCCTAAAAGGTTCCGGGGCTGTGAGGAGGCGGTGGAAGGAAAGGAACCGGA

GGAGAGACCCACGCTGGAGTCGCTGGGATCCCCACCAGATGCAGGAGGCGTGTTGCCTGACACTGACGCCCAGGCTCCGGAGACTGGCCCTGGCGTGGAG

GGTCCCAAGGGTCCCGCTGAGAGTGTGGAGTTGCCCAAAGTTGTCCAG GACCAGGTGCCCAGGCTGCAGCTGCTGCTGAAGGCCTTCCAGGAG GGGCT

GGAGGGTCAGGAGAAGCCCCTAGTGGACCTGCAGTTTCTTCATGAATGTAGTCCCAGCGAG ATGGAGTTGCTATGCAGCGAACTACAGCTACCCCAGCT

CCCTGACGGAGGTCTCCTGCAGCTCTGCAGCCACCTGATGGGTCTCACACCAGCCCTCAGCCTCAGCAATGCCTCTGTGCTGGCCAGGAGCCTCTTTCTT

GACCGG GCTTCTCAGAGTGGCCCTCGTCTCCTTCTGTGTAAAGTACACCTACGCCATCTGCAGGGCTGTCCTCTGTCCCTTGCTCCAGGACCCTCGTGT

AG GTCCTGCGCAGACCGAGTTACTGTGTTCCCTCATAAAGGATGAGTCCCTGGAGTCAGACATGCAGGTCCAGATTTTGGG - UNI31140 - GCAG

GTCCTGGAGCTGGCCTGGCGAGAAGAGACGTTCCTGGTGTTGCAGACGCTCCTGGAACGGCAG GTAGAGATGACCCCTGAGGTGTTCAGTGTCTTAGTG

CAGAGGCTCTGCAAAGAGGGACCAGCAGCCACTACCTCCATGGCCTATGCCAAGCTGATGCTGACGGTGATGACCAAGTACCAGACCAGT ATCACAGAG

CAGCAGAGCCTGGACCTGGCTGTGGCCCTAGAGCCCAACGCCACCTTCCTGAAGAAGGCCCTGCAAGCAGCGCTGAGACATGTGACCCACTGACCATACA

CAAGGACACACCGCCCTGACTGCTTGTCTCAGAACACACAGCCATCTCAGGAGTCAGCTGCCTCTGCCCAACACCCCAGGCTCTGCAGGGGCCATATTGA

CTCCACAAGGAGCAGAGAGGAGGCCTTGGGTACCACTCCTGACAACATCAGGATACAGGGGCTGTGGAGGATGAGTGGGAGGTGGGCAGAAAAGCTGGCC

TTTCAGTGTGAGCCTTTTGTGCTCAGGTATATGTTGTGACCTCCTCTGTTTTGTTTGTTTCTGAACTGAGTAATTTTGTAACAGTTTTAATAAAAAGAAG

ACAGTC
Translation
SLASGALRGWSGAPIPRVLAAAPRPLCAGDAGVGLRSLGRSGALGEPGGPCPPPASG AEHFPWDGFLEALGHLEPEVRGPDGRLEL LVPLLLRLPGVC

QKNLLSLLLALLPSLPESGLRSVLQLHHQDVSSTTDAWLHALGELLRRDVGVGVAEGSSPLTRSCQLQLRDLCGRLGQGGRGLKLALAPDPEQEDRLSQL

CGKRTKEPEEAASPESERSPKRFRGCEEAVEGKEPEERPTLESLGSPPDAGGVLPDTDAQAPETGPGVEGPKGPAESVELPKVVQ DQVPRLQLLLKAFQ

E GLEGQEKPLVDLQFLHECSPSE MELLCSELQLPQLPDGGLLQLCSHLMGLTPALSLSNASVLARSLFLDR ASQSGPRLLLCKVHLRHLQGCPLSLA

PGPSCR RSCADRVTVFPHKG - UNI31140 -   

For any suggestions or comments, please send an email to unitrap@crg.es