Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000007613 (Tgfbr1)
Chromosomal location
Chr 4: 47366177 - 47427795 (+)
Description
transforming growth factor, beta receptor I Gene [Source:MGI (curated);Acc:Tgfbr1-001]
RefSeq_dna
NM_009370 
RefSeq_peptide
NP_033396.1 
UniGene
Mm.400705 Mm.408299 Mm.414760 Mm.197552 
MGI
MGI:98728 
Uniprot/SWISSPROT
Q64729 
Uniprot/SPTREMBL
Q9CVP4 Q9D5H8 A2AJN0 Q3U485 Q4FJL1 
Human Ortholog
ENSG00000106799 (TGFBR1)
Omim 608967 - LOEYS-DIETZ SYNDROME, TYPE 2A  609192 - LOEYS-DIETZ SYNDROME, TYPE 1A  
UniTrap UNI19829
Vector Insertion
Chr 4: 47366269 - 47396620
Public Clones not available
Private Clones OST379345 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34814
Vector Insertion
Chr 4: 47396867 - 47399279
Public Clones IST11177C12 (tigm) IST10099E4 (tigm) IST11575B8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36744
Vector Insertion
Chr 4: 47399362 - 47406130
Public Clones IST14257H6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5806
Vector Insertion
Chr 4: 47409458 - 47415674
Public Clones CSH764 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7141
Vector Insertion
Chr 4: 47419925 - 47423523
Public Clones RRU402 (baygenomics) RRJ579 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107725
Sequence
ATGGATCTAAAGTCACTTATCATGGTGATGATGGAAGACTATAAGGATATAACTCCCTTAAAGAAATTACAGGAGAATAAAG GACCTTTTTCAGAAAAG

CAGTCAGCTGGCCTTGGTCCTGTGGAGCTGGCAGCTGTCATTGCTGGTCCAGTCTGCTTCGTCTGCATTGCACTTATGCTGATGGTCTATATCTGCCATA

ACCGCACTGTCATTCACCACCGTGTGCCAAATGAAGAGGATCCATCACTAGATCGCCCTTTCATTTCAGAGGGCACCACCTTAAAAGATTTAATTTATGA

TATGACAACATCAGGGTCTGGATCAG GTTTACCACTGCTTGTTCAAAGAACAATTGCCAGGACCATTGTGTTACAAGAAAGCATTGGCAAAGGTCGGTT

TGGAGAAGTTTGGCGAGGCAAATGGCGGGGAGAAGAAGTTGCTGTGAAGATATTCTCTTCTAGAGAAGAGCGTTCATGGTTCCGAGAGGCAGAGATTTAT

CAGACTGTAATGTTACGCCATGAAAATATCCTGGGATTTATAGCAGCAGACAACAAAG - UNI5806 - ACAATGGGACATGGACGCAGCTGTGGTTG

GTGTCAGATTATCATGAGCATGGATCCCTTTTCGATTACTTGAATAGATACACTGTTACTGTGGAAGGAATGATCAAGCTTGCTCTGTCCACAGCAAGTG

GTCTTGCCCATCTTCACATGGAGATTGTTGGTACCCAAG GAAAACCAGCTATTGCCCATAGAGATTTGAAATCAAAGAATATCTTGGTGAAGAAAAATG

GAACCTGTTGTATTGCAGACTTGGGACTTGCTGTGAGACATGATTCTGCCACAGATACAATTGATATTGCTCCAAACCACAGAGTAGGCACTAAAAG GT

ACATGGCCCCTGAAGTTCTAGATGATTCCATAAATATGAAACATTTTGAATCCTTCAAACGCGCTGACATCTATGCAATGGGCTTAGTGTTCTGGGAAAT

TGCTCGACGCTGTTCTATTGGTG GAATCCATGAAGACTATCAGTTGCCTTATTATGATCTTGTACCTTCTGATCCATCGGTTGAAGAAATGAGAAAAGT

AGTTTGCGAACAGAAGTTAAGGCCAAATATTCCAAACAGATGGCAGAGCTGTGAG - UNI7141 - GCCTTGAGAGTGATGGCTAAAATTATGAGAGA

ATGCTGGTATGCCAATGGAGCAGCAAGGCTGACAGCTTTGCGAATTAAAAAAACATTGTCACAACTCAGCCAACAGGAAGGCATCAAAATGTAACTGAAA

CACCGTGGGAACTCTGCTCTCTTCATATCTGCTCCTGGGTGTTTAGGAGGCTGGTTGTTCTACCTCACTGAGAGAACAGAGGGCTCTGCTTCCTCTTGCA

GCAGTGGAATATGGTCAACTGAAAGCTTCCCAGGGTTTCTCTGGGCCCAGAGGCAGCCGTGGGGTCCTTTCTGTGCACTATGGATACTTCTTCCAGACAG

TTACAGAATGTTGTGTAGTCTACTTTTGTTTTTATTAACAAAGCTTGTTTTTAAAGACAACTGCCAGCCCTTAGGGAGCTGCTGTGCTGTTGACCTTCTG

TAAGGGTGAAGGAGCTGGGGTGTGGCACTAAATGAAGCACTTCTGATTTTCACTCCTAGTAGTACATTCTCAGAGGACTCTGAACCACTAGTGTTTCCTT

GGTTCACTTTGAATGTACTGTTCTATAATTTTTCAAGATCTTAAACTAACACTTTAAACTCTATAGTCTAAAAAATATGACCTCGTGGAGGCGTGGGGGC

ACAGTTGCTCCGTTGTATTTGTGCACAGCTCCTTCACACTCTGAACACAACACACCTTCACAGTAGGGTTGTGCTACACCAGTAAGTGCTACTTTTGCAT

CTGTCTAAGTGGAAACGAACAGAACTACTTAAAGGCGGTGTTAAGTCCTGTATCATTTTCATTCAAAAAGTTTATTTTTCTGAGTAACCTAAACCTTTTC

TGGGTTTGTTTTTGTTTTTTGAGGGTTTTTGTGATAGATGTCATTCAGTCTTCATGCCTTTCTCCTACCCAGATGTGCTTGAACCACTGAGGCAAGGCTG

TAGCATTGATAAGCAGTGACTGCCATGCGGGAACACCCCACAGGAGCACTGGAGCTCTGCAGTTGAGACGTTTAGCCTGAGTTTATTTTAAGAAGTGAAG

TGGCACTCCAAACATGTACAGTGCTTTATGGATGTAATCATTATGGTATACAGACTCCTTTTGAAAGGGGAGGCTTGTCTATTGCCGAAGGAAAAGTTGT

ATGCTGTTCTGTAAGCCATTTCTTTTTCTTTATTTGATCAAAGCAGTGTTTTGTTTTGTTTTGATTTTTCTTTTTTGGAAAGGAATTGCATTTAAAATTC

AAATGTGGTTAATGTTAAATAATAGGCCTTTTTCTAGGAAGGCAGATATAGTTAATATGAATGTACAAGTGTAGGTGACTTTCACATGTTATGTAGCTGT

AAGTATTTGTGGATTCTATCTTGGGAAGGGTAGAGTTAGTGGAGTTTTGAGGTCTCACTACCCTTTGAGGAAGGCAGCTTTTAATTCAGTCTTTTTATCT

CATATGTGCAGATCTTGCAACTGCTTGATTTACATGGTAGCAATGAATTCAGTGCCACGTTGATACTAGGAGAAGCAGCAACTAATAGCTATTCTGAGTA

GAGGCTCTCTTCATATATTCTTGGTCATATTAAATGTCAAAGTCAGTCCGTTGGGTCTTCTCACTGCTGCTGGAGTTAGGTGGTTGAGCCTGGGTTTTAC

TTCAGTGCTGTCAAATCTTTGCAGGGCTTGTGTGGCTTTCAAAGTCCTTTTTATCACTGTGATCATATTCTGGGCGGGGAAATGTTATCATCATTGCTTG

AGACGAGATGTTGAACATAGTGATACCAATCCCCAGATAAAAAGGTCAAAATAACCTTTAGTGTTTAGCCAAGAAGAGATTGTGACTATTGATCTGAAGC

AGCTGGGCTCTGTTAATGTCTTATTTCAAACCTAGCATACATTTGAAGACTATTTGGTCTTAAACCAAAGTAACTGTAGGACGAATGACATACTACCTAG

ACATTAGTGTCCGTTTCATACGTCAGAAACACCATGGGAAAAAGTACCTAGAGATTAGTATCTTTAATACAAATCTGAGTTTTTTCTGTAATTATCATGA

TTTCATCAATGTAAGTAAGGGTTTGTTGTTACAGTTGTATCACCTGCTTAAATAAGCTCTTGTGCTATAATCAGGTACTTTTGGGGCCTTTGTTTTCAGT

TTTTTCCATTTCTAACCCTTCGAGATCTGCTTTATAGAAATCCAGGGACCAATGTATTTTATCACTAAAACTGTTTTTATATAATTTTAAGACCATACCA

AAAGTTATCTGAGTTAAAGTTGTAATACGTTTCTTACTTTCTTGCAAGGAAATGGGTTTTTACTGAAGACACTTCTCATGATATCTGAAGTTGAAGAATC

ATTATGTTTTTCTTACCTAAGTGGATAAAATGTGCTTTGATGAATCAGGGAATTTTTTAAAGTTCGAATTTAGTTCTAAATTGAGTTTACATGTTTACAG

CTAATTTTTTGTGTAGGGATAGTTTGATTCTCTAGGTGGCCAATACTGAATATAAAAATAACTTAAAAATTGAGATAGGTCATGGTTAATGTGGCTATAA

CTATATATACATCTAATTAGAGAAATATTTCTATGTAATTTTGTAGTGCAGTCTGTTGTTTCTATTGCCAATCAAAGACTTCCCCCCAGCCCCAAAGTGT

AGTATGGCTAAGACATATCTTCTGACAAATTACATATTATCTTGTCAATACCCTGGTTAAGCTAGCATGAAGGAAGTATGACTTACTGAGGCTTACACAA

CTTGAGTCCCTTATATCTTCAGCTCTGTTTTTCCCACTCTGCCTTTCTGCTGCCCCCTGGCTCAGAGACTTAGTGTTCCTGACCCCACCTCCAGCCTTTG

GACCTAAGAGCTGCTTTTGAGACCTAAAATGAAGTGATTGATGGAAGCTGTGTGACATTTTTCCACTTCCTTGAGTCACTGGGTGTTATGAGGGAGTGAT

CTGCAAATTGGGGTAGGGGGTGCCCCTACTGGTAGCCCTGCTTTGATGTCAGCTCTGGGCAAAGATTAGGGTGACAGCTAAGTGGCAGTGGAAGTTGGCC

TCAGAAGTAGTGGCCAGCTGTGTCTCTAGTAGGACAGTAAAGGCATGAAGCTCAGCCTGTAATCCTGCTACTACAGTAGTACTCCAGAAGTGCCTTGAGG

CCCTGTGTGGGGCTGTGGCCATCAAGAATTCCAGATTTTGGTTCTCGCTGCAGACTTAAGTGGCCATGTAGCCATTTTTGTAATCCATACATGTTTGACT

CTTCCCTCTGCAAATTGTCAGATACGTAAAACCAATGACAAACTACTACTTAACATGCACACCAAAATCTGCCCAGAAGACATTGTGATTTCATTCCATG

CACTGAAGGAATGATTGTAAATCATTTCTTTGTTCCTTGGTCATGGGAGTGTTCTGGTTCTACATTGTGGAGATTCCAGCTGTTGTTCTGTTATAGCCCA

GCAGAACAAGTCGACGTGTTGAAATTCTGAAGAATAGTTTGGGAGTGCAGTACAGCTTCATGTGTTGGATGTTGAAACTTTCATGGGCCCTCTTTAGAAA

AGCAGAGGACTGTCAGCACATTATTTTTAATCCTGTTATGCACTCGTACTTATTGTCAGTAACAATAAGTACGAGTATTGAAAATATTGTCAGTAACATT

CAGTCTCTTTCTTAAAGTGAATTTGCTTATTTTTCAATGAGATTTGTGAGTTTAATATTATGAACTGTGTTTTGATAATCCCTTTTTCACATTGTGCCAA

TGGAATGGAATATTTGATATTTCTTTATATGTCAAGGAGATGCTTCAATATGTCATTTGCTTTAAACTTAAATTACCTCTCAAGAGACCAAGGTACATTT

ACCTCATTGTGTATATAATGTTTAATATTTGTCAGCATCCACCAGGTTTGCAATTTTATTTCTATAAAGTGTGAGTGTTACGTTGCTAAGTTACTCAGAT

GGTACTGTATTGTTTATATCTGTACCCCAAATGACATCATCTAGACTTTGTTTTCTGTGTCTTATTGTATTTGTGCAGTCCTTTAACCCTGTTGGTGTGA

TTGCTGCCCTTTCAGATATGTGCAGGTGTCTATAGAAATTCTCATTTAAGGTGAATGGTTTTGAGAAACCTGTGAAGAGAGAAGCATAAACTGCATTTCC

CCATCAGTTTTTTAAATGTACATTGTATGTGTAGTAATATTCCAGATGAATTGTAAATAAAAGCTAGGGAGATGCTTAAATTTCATCCTAACACTACAGT

AGAAAATGGAAGCAATGCAAATAAACAACTTTTTCCCACC
Translation
MDLKSLIMVMMEDYKDITPLKKLQENKG GPFSEKQSAGLGPVELAAVIAGPVCFVCIALMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLI

YDMTTSGSGSG GLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKD - UNI5806

 - DNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQG GKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATD

TIDIAPNHRVGTKR RYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGG GIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQ

SCE - UNI7141 - ALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEGIKM
Transcript ENSMUST00000044234
Sequence
GGACCATGGAGGCGGCGGCCGCTGCTCCACGTCGTCCGCAGCTCCTCATCGTGTTGGTGGCGGCGGCGACGCTGCTCCCGGGGGCGAAGG - UNI1982

9 - CATTACAGTGTTTCTGCCACCTCTGTACAAAGGATAATTTTACCTGTGAGACAGATGGTCTTTGCTTTGTCTCAGTCACTGAGACCACAGACAAAG

TTATACACAATAGTATGTGTATAGCTGAAATTGACCTAATTCCTCGAGACAGGCCATTTGTATGTGCACCATCTTCAAAAACAGGGGCAGTTACTACAAC

ATATTGCTGCAATCAGGACCACTGCAATAAAATAGAACTCCCAACTACAG AAAAGCAGTCAGCTGGCCTTGGTCCTGTGGAGCTGGCAGCTGTCATTGC

TGGTCCAGTCTGCTTCGTCTGCATTGCACTTATGCTGATGGTCTATATCTGCCATAACCGCACTGTCATTCACCACCGTGTGCCAAATGAAGAGGATCCA

TCACTAGATCGCCCTTTCATTTCAGAGGGCACCACCTTAAAAGATTTAATTTATGATATGACAACATCAGGGTCTGGATCAG GTTTACCACTGCTTGTT

CAAAGAACAATTGCCAGGACCATTGTGTTACAAGAAAGCATTGGCAAAGGTCGGTTTGGAGAAGTTTGGCGAGGCAAATGGCGGGGAGAAGAAGTTGCTG

TGAAGATATTCTCTTCTAGAGAAGAGCGTTCATGGTTCCGAGAGGCAGAGATTTATCAGACTGTAATGTTACGCCATGAAAATATCCTGGGATTTATAGC

AGCAGACAACAAAG - UNI5806 - ACAATGGGACATGGACGCAGCTGTGGTTGGTGTCAGATTATCATGAGCATGGATCCCTTTTCGATTACTTGAA

TAGATACACTGTTACTGTGGAAGGAATGATCAAGCTTGCTCTGTCCACAGCAAGTGGTCTTGCCCATCTTCACATGGAGATTGTTGGTACCCAAG GAAA

ACCAGCTATTGCCCATAGAGATTTGAAATCAAAGAATATCTTGGTGAAGAAAAATGGAACCTGTTGTATTGCAGACTTGGGACTTGCTGTGAGACATGAT

TCTGCCACAGATACAATTGATATTGCTCCAAACCACAGAGTAGGCACTAAAAG GTACATGGCCCCTGAAGTTCTAGATGATTCCATAAATATGAAACAT

TTTGAATCCTTCAAACGCGCTGACATCTATGCAATGGGCTTAGTGTTCTGGGAAATTGCTCGACGCTGTTCTATTGGTG GAATCCATGAAGACTATCAG

TTGCCTTATTATGATCTTGTACCTTCTGATCCATCGGTTGAAGAAATGAGAAAAGTAGTTTGCGAACAGAAGTTAAGGCCAAATATTCCAAACAGATGGC

AGAGCTGTGAG - UNI7141 - GCCTTGAGAGTGATGGCTAAAATTATGAGAGAATGCTGGTATGCCAATGGAGCAGCAAGGCTGACAGCTTTGCGAA

TTAAAAAAACATTGTCACAACTCAGCCAACAGGAAGGCATCAAAATGTAACTGAAACACCGTGGGAACTCTGCTCTCTTCATATCTGCTCCTGGGTGTTT

AGGAGGCTGGTTGTTCTACCTCACTGAGAGAACAGAGGGCTCTGCTTCCTCTTGCAGCAGTGGAATATGGTCAACTGAAAGCTTCCCAGGGTTTCTCTGG

GCCCAGAGGCAGCCGTGGGGTCCTTTCTGTGCACTATGGATACTTCTTCCAGACAGTTACAGAATGTTGTGTAGTCTACTTTTGTTTTTATTAACAAAGC

TTGTTTTTAAAGACAACTGCCAGCCCTTAGGGAGCTGCTGTGCTGTTGACCTTCTGTAAGGGTGAAGGAGCTGGGGTGTGGCACTAAATGAAGCACTTCT

GATTTTCACTCCTAGTAGTACATTCTCAGAGGACTCTGAACCACTAGTGTTTCCTTGGTTCACTTTGAATGTACTGTTCTATAATTTTTCAAGATCTTAA

ACTAACACTTTAAACTCTATAGTCTAAAAAATATGACCTCGTGGAGGCGTGGGGGCACAGTTGCTCCGTTGTATTTGTGCACAGCTCCTTCACACTCTGA

ACACAACACACCTTCACAGTAGGGTTGTGCTACACCAGTAAGTGCTACTTTTGCATCTGTCTAAGTGGAAACGAACAGAACTACTTAAAGGCGGTGTTAA

GTCCTGTATCATTTTCATTCAAAAAGTTTATTTTTCTGAGTAACCTAAACCTTTTCTGGGTTTGTTTTTGTTTTTTGAGGGTTTTTGTGATAGATGTCAT

TCAGTCTTCATGCCTTTCTCCTACCCAGATGTGCTTGAACCACTGAGGCAAGGCTGTAGCATTGATAAGCAGTGACTGCCATGCGGGAACACCCCACAGG

AGCACTGGAGCTCTGCAGTTGAGACGTTTAGCCTGAGTTTATTTTAAGAAGTGAAGTGGCACTCCAAACATGTACAGTGCTTTATGGATGTAATCATTAT

GGTATACAGACTCCTTTTGAAAGGGGAGGCTTGTCTATTGCCGAAGGAAAAGTTGTATGCTGTTCTGTAAGCCATTTCTTTTTCTTTATTTGATCAAAGC

AGTGTTTTGTTTTGTTTTGATTTTTCTTTTTTGGAAAGGAATTGCATTTAAAATTCAAATGTGGTTAATGTTAAATAATAGGCCTTTTTCTAGGAAGGCA

GATATAGTTAATATGAATGTACAAGTGTAGGTGACTTTCACATGTTATGTAGCTGTAAGTATTTGTGGATTCTATCTTGGGAAGGGTAGAGTTAGTGGAG

TTTTGAGGTCTCACTACCCTTTGAGGAAGGCAGCTTTTAATTCAGTCTTTTTATCTCATATGTGCAGATCTTGCAACTGCTTGATTTACATGGTAGCAAT

GAATTC
Translation
MEAAAAAPRRPQLLIVLVAAATLLPGAKA - UNI19829 - ALQCFCHLCTKDNFTCETDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPS

SKTGAVTTTYCCNQDHCNKIELPTTE EKQSAGLGPVELAAVIAGPVCFVCIALMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTTS

GSGSG GLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKD - UNI5806 - DNG

TWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQG GKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAP

NHRVGTKR RYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGG GIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCE - 

UNI7141 - ALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEGIKM
Transcript ENSMUST00000007757
Sequence
CGGGACCATGGAGGCGGCGGCCGCTGCTCCACGTCGTCCGCAGCTCCTCATCGTGTTGGTGGCGGCGGCGACGCTGCTCCCGGGGGCGAAGG - UNI19

829 - CATTACAGTGTTTCTGCCACCTCTGTACAAAGGATAATTTTACCTGTGAGACAGATGGTCTTTGCTTTGTCTCAGTCACTGAGACCACAGACAA

AGTTATACACAATAGTATGTGTATAGCTGAAATTGACCTAATTCCTCGAGACAGGCCATTTGTATGTGCACCATCTTCAAAAACAGGGGCAGTTACTACA

ACATATTGCTGCAATCAGGACCACTGCAATAAAATAGAACTCCCAACTACAG GACCTTTTTCAGAAAAGCAGTCAGCTGGCCTTGGTCCTGTGGAGCTG

GCAGCTGTCATTGCTGGTCCAGTCTGCTTCGTCTGCATTGCACTTATGCTGATGGTCTATATCTGCCATAACCGCACTGTCATTCACCACCGTGTGCCAA

ATGAAGAGGATCCATCACTAGATCGCCCTTTCATTTCAGAGGGCACCACCTTAAAAGATTTAATTTATGATATGACAACATCAGGGTCTGGATCAG GTT

TACCACTGCTTGTTCAAAGAACAATTGCCAGGACCATTGTGTTACAAGAAAGCATTGGCAAAGGTCGGTTTGGAGAAGTTTGGCGAGGCAAATGGCGGGG

AGAAGAAGTTGCTGTGAAGATATTCTCTTCTAGAGAAGAGCGTTCATGGTTCCGAGAGGCAGAGATTTATCAGACTGTAATGTTACGCCATGAAAATATC

CTGGGATTTATAGCAGCAGACAACAAAG - UNI5806 - ACAATGGGACATGGACGCAGCTGTGGTTGGTGTCAGATTATCATGAGCATGGATCCCTT

TTCGATTACTTGAATAGATACACTGTTACTGTGGAAGGAATGATCAAGCTTGCTCTGTCCACAGCAAGTGGTCTTGCCCATCTTCACATGGAGATTGTTG

GTACCCAAG GAAAACCAGCTATTGCCCATAGAGATTTGAAATCAAAGAATATCTTGGTGAAGAAAAATGGAACCTGTTGTATTGCAGACTTGGGACTTG

CTGTGAGACATGATTCTGCCACAGATACAATTGATATTGCTCCAAACCACAGAGTAGGCACTAAAAG GTACATGGCCCCTGAAGTTCTAGATGATTCCA

TAAATATGAAACATTTTGAATCCTTCAAACGCGCTGACATCTATGCAATGGGCTTAGTGTTCTGGGAAATTGCTCGACGCTGTTCTATTGGTG GAATCC

ATGAAGACTATCAGTTGCCTTATTATGATCTTGTACCTTCTGATCCATCGGTTGAAGAAATGAGAAAAGTAGTTTGCGAACAGAAGTTAAGGCCAAATAT

TCCAAACAGATGGCAGAGCTGTGAG - UNI7141 - GCCTTGAGAGTGATGGCTAAAATTATGAGAGAATGCTGGTATGCCAATGGAGCAGCAAGGCT

GACAGCTTTGCGAATTAAAAAAACATTGTCACAACTCAGCCAACAGGAAGGCATCAAAATGTAACTGAAACACCGTGGGAACTCTGCTCTCTTCATATCT

GCTCCTGGGTGTTTAGGAGGCTGGTTGTTCTACCTCACTGAGAGAACAGAGGGCTCTGCTTCCTCTTGCAGCAGTGGAATATGGTCAACTGAAAGCTTCC

CAGGGTTTCTCTGGGCCCAGAGGCAGCCGTGGGGTCCTTTCTGTGCACTATGGATACTTCTTCCAGACAGTTACAGAATGTTGTGTAGTCTACTTTTGTT

TTTATTAACAAAGCTTGTTTTTAAAGACAACTGCCAGCCCTTAGGGAGCTGCTGTGCTGTTGACCTTCTGTAAGGGTGAAGGAGCTGGGGTGTGGCACTA

AATGAAGCACTTCTGATTTTCACTCCTAGTAGTACATTCTCAGAGGACTCTGAACCACTAGTGTTTCCTTGGTTCACTTTGAATGTACTGTTCTATAATT

TTTCAAGATCTTAAACTAACACTTTAAACTCTATAGTCTAAAAAATATGACCTCGTGGAGGCGTGGGGGCACAGTTGCTCCGTTGTATTTGTGCACAGCT

CCTTCACACTCTGAACACAACACACCTTCACAGTAGGGTTGTGCTACACCAGTAAGTGCTACTTTTGCATCTGTCTAAGTGGAAACGAACAGAACTACTT

AAAGGCGGTGTTAAGTCCTGTATCATTTTCATTCAAAAAGTTTATTTTTCTGAGTAACCTAAACCTTTTCTGGGTTTGTTTTTGTTTTTTGAGGGTTTTT

GTGATAGATGTCATTCAGTCTTCATGCCTTTCTCCTACCCAGATGTGCTTGAACCACTGAGGCAAGGCTGTAGCATTGATAAGCAGTGACTGCCATGCGG

GAACACCCCACAGGAGCACTGGAGCTCTGCAGTTGAGACGTTTAGCCTGAGTTTATTTTAAGAAGTGAAGTGGCACTCCAAACATGTACAGTGCTTTATG

GATGTAATCATTATGGTATACAGACTCCTTTTGAAAGGGGAGGCTTGTCTATTGCCGAAGGAAAAGTTGTATGCTGTTCTGTAAGCCATTTCTTTTTCTT

TATTTGATCAAAGCAGTGTTTTGTTTTGTTTTGATTTTTCTTTTTTGGAAAGGAATTGCATTTAAAATTCAAATGTGGTTAATGTTAAATAATAGGCCTT

TTTCTAGGAAGGCAGATATAGTTAATATGAATGTACAAGTGTAGGTGACTTTCACATGTTATGTAGCTGTAAGTATTTGTGGATTCTATCTTGGGAAGGG

TAGAGTTAGTGGAGTTTTGAGGTCTCACTACCCTTTGAGGAAGGCAGCTTTTAATTCAGTCTTTTTATCTCATATGTGCAGATCTTGCAACTGCTTGATT

TACATGGTAGCAATGAATTCAGTGCCACGTTGATACTAGGAGAAGCAGCAACTAATAGCTATTCTGAGTAGAGGCTCTCTTCATATATTCTTGGTCATAT

TAAATGTCAAAGTCAGTCCGTTGGGTCTTCTCACTGCTGCTGGAGTTAGGTGGTTGAGCCTGGGTTTTACTTCAGTGCTGTCAAATCTTTGCAGGGCTTG

TGTGGCTTTCAAAGTCCTTTTTATCACTGTGATCATATTCTGGGCGGGGAAATGTTATCATCATTGCTTGAGACGAGATGTTGAACATAGTGATACCAAT

CCCCAGATAAAAAGGTCAAAATAACCTTTAGTGTTTAGCCAAGAAGAGATTGTGACTATTGATCTGAAGCAGCTGGGCTCTGTTAATGTCTTATTTCAAA

CCTAGCATACATTTGAAGACTATTTGGTCTTAAACCAAAGTAACTGTAGGACGAATGACATACTACCTAGACATTAGTGTCCGTTTCATACGTCAGAAAC

ACCATGGGAAAAAGTACCTAGAGATTAGTATCTTTAATACAAATCTGAGTTTTTTCTGTAATTATCATGATTTCATCAATGTAAGTAAGGGTTTGTTGTT

ACAGTTGTATCACCTGCTTAAATAAGCTCTTGTGCTATAATCAGGTACTTTTGGGGCCTTTGTTTTCAGTTTTTTCCATTTCTAACCCTTCGAGATCTGC

TTTATAGAAATCCAGGGACCAATGTATTTTATCACTAAAACTGTTTTTATATAATTTTAAGACCATACCAAAAGTTATCTGAGTTAAAGTTGTAATACGT

TTCTTACTTTCTTGCAAGGAAATGGGTTTTTACTGAAGACACTTCTCATGATATCTGAAGTTGAAGAATCATTATGTTTTTCTTACCTAAGTGGATAAAA

TGTGCTTTGATGAATCAGGGAATTTTTTAAAGTTCGAATTTAGTTCTAAATTGAGTTTACATGTTTACAGCTAATTTTTTGTGTAGGGATAGTTTGATTC

TCTAGGTGGCCAATACTGAATATAAAAATAACTTAAAAATTGAGATAGGTCATGGTTAATGTGGCTATAACTATATATACATCTAATTAGAGAAATATTT

CTATGTAATTTTGTAGTGCAGTCTGTTGTTTCTATTGCCAATCAAAGACTTCCCCCCAGCCCCAAAGTGTAGTATGGCTAAGACATATCTTCTGACAAAT

TACATATTATCTTGTCAATACCCTGGTTAAGCTAGCATGAAGGAAGTATGACTTACTGAGGCTTACACAACTTGAGTCCCTTATATCTTCAGCTCTGTTT

TTCCCACTCTGCCTTTCTGCTGCCCCCTGGCTCAGAGACTTAGTGTTCCTGACCCCACCTCCAGCCTTTGGACCTAAGAGCTGCTTTTGAGACCTAAAAT

GAAGTGATTGATGGAAGCTGTGTGACATTTTTCCACTTCCTTGAGTCACTGGGTGTTATGAGGGAGTGATCTGCAAATTGGGGTAGGGGGTGCCCCTACT

GGTAGCCCTGCTTTGATGTCAGCTCTGGGCAAAGATTAGGGTGACAGCTAAGTGGCAGTGGAAGTTGGCCTCAGAAGTAGTGGCCAGCTGTGTCTCTAGT

AGGACAGTAAAGGCATGAAGCTCAGCCTGTAATCCTGCTACTACAGTAGTACTCCAGAAGTGCCTTGAGGCCCTGTGTGGGGCTGTGGCCATCAAGAATT

CCAGATTTTGGTTCTCGCTGCAGACTTAAGTGGCCATGTAGCCATTTTTGTAATCCATACATGTTTGACTCTTCCCTCTGCAAATTGTCAGATACGTAAA

ACCAATGACAAACTACTACTTAACATGCACACCAAAATCTGCCCAGAAGACATTGTGATTTCATTCCATGCACTGAAGGAATGATTGTAAATCATTTCTT

TGTTCCTTGGTCATGGGAGTGTTCTGGTTCTACATTGTGGAGATTCCAGCTGTTGTTCTGTTATAGCCCAGCAGAACAAGTCGACGTGTTGAAATTCTGA

AGAATAGTTTGGGAGTGCAGTACAGCTTCATGTGTTGGATGTTGAAACTTTCATGGGCCCTCTTTAGAAAAGCAGAGGACTGTCAGCACATTATTTTTAA

TCCTGTTATGCACTCGTACTTATTGTCAGTAACAATAAGTACGAGTATTGAAAATATTGTCAGTAACATTCAGTCTCTTTCTTAAAGTGAATTTGCTTAT

TTTTCAATGAGATTTGTGAGTTTAATATTATGAACTGTGTTTTGATAATCCCTTTTTCACATTGTGCCAATGGAATGGAATATTTGATATTTCTTTATAT

GTCAAGGAGATGCTTCAATATGTCATTTGCTTTAAACTTAAATTACCTCTCAAGAGACCAAGGTACATTTACCTCATTGTGTATATAATGTTTAATATTT

GTCAGCATCCACCAGGTTTGCAATTTTATTTCTATAAAGTGTGAGTGTTACGTTGCTAAGTTACTCAGATGGTACTGTATTGTTTATATCTGTACCCCAA

ATGACATCATCTAGACTTTGTTTTCTGTGTCTTATTGTATTTGTGCAGTCCTTTAACCCTGTTGGTGTGATTGCTGCCCTTTCAGATATGTGCAGGTGTC

TATAGAAATTCTCATTTAAGGTGAATGGTTTTGAGAAACCTGTGAAGAGAGAAGCATAAACTGCATTTCCCCATCAGTTTTTTAAATGTACATTGTATGT

GTAGTAATATTCCAGATGAATTGTAAATAAAAGCTAGGGAGATGCTTAAATTTCATCCTAACACTACAGTAGAAAATGGAAGCAATGCAAATAAACAACT

TTTTCCCACC
Translation
MEAAAAAPRRPQLLIVLVAAATLLPGAKA - UNI19829 - ALQCFCHLCTKDNFTCETDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPS

SKTGAVTTTYCCNQDHCNKIELPTTG GPFSEKQSAGLGPVELAAVIAGPVCFVCIALMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYD

MTTSGSGSG GLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKD - UNI5806 -

 DNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQG GKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTI

DIAPNHRVGTKR RYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGG GIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSC

E - UNI7141 - ALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEGIKM

For any suggestions or comments, please send an email to unitrap@crg.es