Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000007659 (Bcl2l1)
Chromosomal location
Chr 2: 152593052 - 152657464 (-)
Description
BCL2-like 1 Gene [Source:MGI (curated);Acc:Bcl2l1-001]
RefSeq_dna
NM_009743 
RefSeq_peptide
NP_033873.3 
UniGene
Mm.238213 
MGI
MGI:88139 
Uniprot/SWISSPROT
Q64373 
Uniprot/SPTREMBL
A2AHX7 A2AHX8 A2AHX9 O35843 Q99N36 Q9QWX2 Q3T9W4 Q5HZH3 Q99N35 
Human Ortholog
ENSG00000171552 (BCL2L1)
Omim not available
UniTrap UNI9897
Vector Insertion
Chr 2: 152656403 - 152657338
Public Clones (sanger) NPX268 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22643
Vector Insertion
Chr 2: 152655839 - 152656121
Public Clones D090B02 (ggtc) IST12190G7HMR1 (tigm)
Private Clones OST289185 (lexicon) OST88015 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25321
Vector Insertion
Chr 2: 152655162 - 152655839
Public Clones not available
Private Clones OST187857 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3494
Vector Insertion
Chr 2: 152655035 - 152655162
Public Clones AP0696 (sanger) AS0993 (sanger) AR1189 (sanger) AR0269 (sanger)
AS0680 (sanger) AT0199 (sanger) AR0256 (sanger) AR1180 (sanger)
AQ0654 (sanger) AV0189 (sanger) AQ0432 (sanger) AL0662 (sanger)
AQ0666 (sanger) AR1002 (sanger) AS0758 (sanger) AS0677 (sanger)
AL0418 (sanger) AQ0716 (sanger) AR0408 (sanger) AN0071 (sanger)
AV0131 (sanger) AQ1036 (sanger) AR1208 (sanger) AV0627 (sanger)
AR0493 (sanger) AS0525 (sanger) AQ0670 (sanger) AF0495 (sanger)
AQ0669 (sanger) H002E05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16383
Vector Insertion
Chr 2: 152608019 - 152655022
Public Clones (sanger) 5SE386H08 (ggtc) 5SE167C08 (ggtc) 3SE386H08 (ggtc) 3SE167C08 (ggtc)
H002E05 (ggtc) CMHD-GT_249F11-3 (cmhd) CMHD-GT_360A12-3 (cmhd) CMHD-GT_519C5-5S (cmhd)
CMHD-GT_500G1-3 (cmhd) CMHD-GT_450F11-3 (cmhd) CMHD-GT_391C12-3 (cmhd) CMHD-GT_172C8-3 (cmhd)
CMHD-GT_475G8-3 (cmhd) CMHD-GT_545D11-5S (cmhd) CMHD-GT_384A10-3 (cmhd) CMHD-GT_545D11-3 (cmhd)
IST14409H9 (tigm) IST13040D4 (tigm) IST11079C6 (tigm) IST12324D11 (tigm)
IST12746C11 (tigm) IST10008B8 (tigm) IST12387G12 (tigm) IST12557F8 (tigm)
IST10875D5 (tigm) IST12847G6 (tigm) IST10070C8 (tigm) IST14729E5 (tigm)
IST10846E10 (tigm) IST12815F8 (tigm) IST10768A8 (tigm) IST12929B2 (tigm)
IST15063D12 (tigm) IST10204B9 (tigm) IST11709B6 (tigm) IST12366A6 (tigm)
IST12847A12 (tigm) IST11139H5 (tigm) IST12443E2 (tigm) IST14780H5 (tigm)
IST14756G7 (tigm) IST13741C5 (tigm) IST12899G5 (tigm)
Private Clones OST461931 (lexicon) OST448394 (lexicon) OST441594 (lexicon) OST436826 (lexicon)
OST391582 (lexicon) OST379295 (lexicon) OST378118 (lexicon) OST367865 (lexicon)
OST351228 (lexicon) OST329865 (lexicon) OST328585 (lexicon) OST306593 (lexicon)
OST287334 (lexicon) OST286006 (lexicon) OST281161 (lexicon) OST247790 (lexicon)
OST242999 (lexicon) OST190988 (lexicon) OST115054 (lexicon) OST112383 (lexicon)
OST98550 (lexicon) OST14253 (lexicon)
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13038
Vector Insertion
Chr 2: 152606407 - 152608019
Public Clones CMHD-GT_342F12-3 (cmhd) CMHD-GT_163E11-3 (cmhd) CMHD-GT_359E3-3 (cmhd) CMHD-GT_148F3-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27157
Vector Insertion
Chr 2: 152593196 - 152606407
Public Clones IST10954H5 (tigm) IST12818E7 (tigm) IST12742H10 (tigm)
Private Clones OST68157 (lexicon)
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000089053
Sequence
CGGGTGGCTGGAGCCTGCGGAGCAGAGAGAGGCCGCCCTCGATCTGGTCGATGGAGGAACCAGGTTGTGAGGGGGCAGGTTCCTAAGCTTCGCAATTCCT

CTGTCGCCTTCTGAGCTGCCTACCAGGTCGCATGATCCCTCCGGCCGGGGCTGGTTTTTTTTTTTTTTTTTTTTTTTTGCTGAGTTACCGGCGACCCAGC

CACCACCTCCTCCCCGACCTATGATACAAAAGACCTTCCGGGGGTTGTACCTGCTTGCTGTCGCCGGAGATAGATTTGAAT - UNI22643 - - UNI

25321 - AACCTTATCTTGGCTTTGGATCCTGGAAGAGAATCGCTAAACACAGAGCAGACCCAGTAAGTGAGCAGGTGTTTTGGACAATGGACTGGTTG

AGCCCATCTCTATTATAAAAATGTCTCAGAGCAACCGGGAGCTGGTGGTCGACTTTCTCTCCTACAAGCTTTCCCAGAAAGGATACAGCTGGAGTCAGTT

TAGTGATGTCGAAGAGAATAGGACTGAGGCCCCAGAAGAAACTGAAGCAGAGAGGGAGACCCCCAGTGCCATCAATGGCAACCCATCCTGGCACCTGGCG

GATAGCCCGGCCGTGAATGGAGCCACTGGCCACAGCAGCAGTTTGGATGCGCGGGAGGTGATTCCCATGGCAGCAGTGAAGCAAGCGCTGAGAGAGGCAG

GCGATGAGTTTGAACTGCGGTACCGGAGAGCGTTCAGTGATCTAACATCCCAGCTTCACATAACCCCAGGGACCGCGTATCAGAGCTTTGAGCAGGTAGT

GAATGAACTCTTTCGGGATGGAGTAAACTGGGGTCGCATCGTGGCCTTTTTCTCCTTTGGCGGGGCACTGTGCGTGGAAAGCGTAGACAAGGAGATGCAG

GTATTGGTGAGTCGGATTGCAAGTTGGATGGCCACCTATCTGAATGACCACCTAGAGCCTTGGATCCAGGAGAACGGCGGCTGG - UNI3494 - - U

NI13038 - - UNI16383 - - UNI25321 - - UNI27157 - GGTGTGAGTGGAGGTACACCCCTCAGATCTGTCTTCAGAAGGCTTGTTCAA

GTGCCAGGAGTGGCGGAGCACGTTTGTGATCCCAGCCTTTGGGAGGTGGAAACAGAAGGATCGGAAGTTCAAGGCCCTCCTCAGCTATTATAG
Translation
 - UNI22643 - - UNI25321 - MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSS

SLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATY

LNDHLEPWIQENGGW - UNI3494 - - UNI13038 - - UNI16383 - - UNI25321 - - UNI27157 - GVSGGTPLRSVFRRLVQVPG

VAEHVCDPSLWEVETEGSEVQGPPQLL
Transcript ENSMUST00000109820
Sequence
CGGGTGGCTGGAGCCTGCGGAGCAGAGAGAGGCCGCCCTCGATCTGGTCGATGGAGGAACCAGGTTGTGAGGGGGCAGGTTCCTAAGCTTCGCAATTCCT

CTGTCGCCTTCTGAGCTGCCTACCAGGTCGCATGATCCCTCCGGCCGGGGCTGGTTTTTTTTTTTTTTTTTTTTTTTTGCTGAGTTACCGGCGACCCAGC

CACCACCTCCTCCCCGACCTATGATACAAAAGACCTTCCGGGGGTTGTACCTGCTTGCTGTCGCCGGAGATAGATTTGAAT - UNI22643 - - UNI

25321 - AACCTTATCTTGGCTTTGGATCCTGGAAGAGAATCGCTAAACACAGAGCAGACCCAGTAAGTGAGCAGGTGTTTTGGACAATGGACTGGTTG

AGCCCATCTCTATTATAAAAATGTCTCAGAGCAACCGGGAGCTGGTGGTCGACTTTCTCTCCTACAAGCTTTCCCAGAAAGGATACAGCTGGAGTCAGTT

TAGTGATGTCGAAGAGAATAGGACTGAGGCCCCAGAAGAAACTGAAGCAGAGAGGGAGACCCCCAGTGCCATCAATGGCAACCCATCCTGGCACCTGGCG

GATAGCCCGGCCGTGAATGGAGCCACTGGCCACAGCAGCAGTTTGGATGCGCGGGAGGTGATTCCCATGGCAGCAGTGAAGCAAGCGCTGAGAGAGGCAG

GCGATGAGTTTGAACTGCGGTACCGGAGAGCGTTCAGTGATCTAACATCCCAGCTTCACATAACCCCAGGGACCGCGTATCAGAGCTTTGAGCAGGTAGT

GAATGAACTCTTTCGGGATGGAGTAAACTGGGGTCGCATCGTGGCCTTTTTCTCCTTTGGCGGGGCACTGTGCGTGGAAAGCGTAGACAAGGAGATGCAG

GTATTGGTGAGTCGGATTGCAAGTTGGATGGCCACCTATCTGAATGACCACCTAGAGCCTTGGATCCAGGAGAACGGCGGCTGG - UNI3494 - - U

NI13038 - - UNI16383 - - UNI25321 - GACACTTTTGTGGATCTCTACGGGAACAATGCAGCAGCCGAGAGCCGGAAAGGCCAGGAGCGCT

TCAACCGCTGGTTCCTGACGGGCATGACTGTGGCTGGTGTGGTTCTGCTGGGCTCACTCTTCAGTCGGAAGTGACCAGACACTGACCGTCCACTCACCTC

TCACCTCCCACCCTGCCCCCACCACAACTCTCTCTTCAGCCACCATTGCTACCAGGAGAACCACTACATGCAACTCACGCCCCTTGCCCTATCACAGGGT

TGGGCCTAGACGGAGTCCCCTGCAATTAGCTTTCTAGGATCTACCACACTTCTGTGAAAGCCACCTTCCCCCCACATCTCAGTTCTCTTGGCCTCAAAAC

TCACAAGGTTTTCCCCTAAACCAGCTCCTTGGAGGCTGGCAGGAGCAGAGAGGGGTGTGTGAGGGAGGAGAGCCTGTCTTGTTGGTGGGACCCTAATTAC

CCCTGAGCCTCTCGGGAATGCTTTTCCAGCAGGGAGCTCTTCCCCTGAAGGAGACTAGCTTGCCTTGGTTTTGATGTGTGTGGCCTCAGACGTGATCATT

TCCCATCCCGCTGTGTCTCTGGGTCTCCCTCCTCCCCATCTCCACCCCCCAAGAGCCATTGAGTGAGGTGCTTTTAGCCCTTTTGACTAATTAGAAATTC

AGGCTGCTTGGGATAATGAGACAAGGACCAGAACCTCCTCCCCACCTGTGGCCTGGCCAAAACCCCCACTTGTGGTCTGAATGTTCTCCTGAGGCCTCTG

GCTAGAGTCTAGCCCCACCCAGGGGGAGGGGCTTAGCTGCTGAAAGTCCACCTTGCTAGAGCTAGGGTGGCTCTTGCAGCTTAGCACCCCCCAAGATCCT

TGTCCACCCCTCCCCTGGCTCCCATGACCATGACTGAGGGACCAATGGGCCCAAGATAGGTGCCCCAGAGCTGTTAATGACTTCAGCTGCCTCACTTCCT

GCAAGATTGGCCTGTGGCATCTTTGCCTTGGGTGTTGGCCACAGGGTCAAGGGACTCTGGCCTCAGCCCAGAAGTGAGGGGAAGCTATACAGAGCAGCTG

TGGGAACCCCAGGGGCTTCCCTACCTCAGGCAGGAAGGGCAGGAAGAAGAGCCTGGAGCCCAGGCGAGGGGGACGGCAAGGGCCTGTCTTTGTGCTCTGC

CCCACCTAGCCTGGGCAGCAGGGCTGCCAAGGTCAGAATGGCCTGGCTAGGAGCCCTTCAGGCCTCTCTCTCCTCTGTCCACCCTTGGCCTGTCTCATCC

CTGTGGGTCCCAGCTCAGCTCTGGCCACCCCGGGCTCTCTGCTGTACATATTCGAGACTAGTTTTTATTCCTTGTGAAGATGATATACTATTTTTGTTAA

GCGTGTCTGTATTTATGTGTGAGGAGCTGCTGGCTTGCTGTGCGCGTGCCCGTGGAGAGCTGGTGCCCAGAGACTGACAGCCTGATGCTCCCTCCCTGCC

CTTGCCTGGGGAAGCCCACCAGGGGTTCTGGCTTCTGAGGGGCACCTGTCCCTCCTCTCCCCTCACCCTACACTTGTTCCAGCTCTTTGAAATAGTTTGT

GTGAAGGTGAAAGTGCAGTTCAGTAATAAATGGTGTCTGTGACTCTG
Translation
 - UNI22643 - - UNI25321 - MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSS

SLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATY

LNDHLEPWIQENGGW - UNI3494 - - UNI13038 - - UNI16383 - - UNI25321 - DTFVDLYGNNAAAESRKGQERFNRWFLTGMTVA

GVVLLGSLFSRK
Transcript ENSMUST00000007803
Sequence
TTTGCGTCTCGGGCTCGCGCGCGCTGCCGCGGCACCGGAAGTGGCTGCGCTTGCAAGTTCCCCCGGTCTCTTCAGGGGAAACTGAGGCCGGCTTCTCCGG

GAGATTCAGCACGAGCAGTCAGCCAG - UNI9897 - - UNI22643 - - UNI25321 - AACCTTATCTTGGCTTTGGATCCTGGAAGAGAATC

GCTAAACACAGAGCAGACCCAGTAAGTGAGCAGGTGTTTTGGACAATGGACTGGTTGAGCCCATCTCTATTATAAAAATGTCTCAGAGCAACCGGGAGCT

GGTGGTCGACTTTCTCTCCTACAAGCTTTCCCAGAAAGGATACAGCTGGAGTCAGTTTAGTGATGTCGAAGAGAATAGGACTGAGGCCCCAGAAGAAACT

GAAGCAGAGAGGGAGACCCCCAGTGCCATCAATGGCAACCCATCCTGGCACCTGGCGGATAGCCCGGCCGTGAATGGAGCCACTGGCCACAGCAGCAGTT

TGGATGCGCGGGAGGTGATTCCCATGGCAGCAGTGAAGCAAGCGCTGAGAGAGGCAGGCGATGAGTTTGAACTGCGGTACCGGAGAGCGTTCAGTGATCT

AACATCCCAGCTTCACATAACCCCAGGGACCGCGTATCAGAGCTTTGAGCAGGTAGTGAATGAACTCTTTCGGGATGGAGTAAACTGGGGTCGCATCGTG

GCCTTTTTCTCCTTTGGCGGGGCACTGTGCGTGGAAAGCGTAGACAAGGAGATGCAGGTATTGGTGAGTCGGATTGCAAGTTGGATGGCCACCTATCTGA

ATGACCACCTAGAGCCTTGGATCCAGGAGAACGGCGGCTGG - UNI3494 - - UNI13038 - - UNI16383 - - UNI25321 - GACACTT

TTGTGGATCTCTACGGGAACAATGCAGCAGCCGAGAGCCGGAAAGGCCAGGAGCGCTTCAACCGCTGGTTCCTGACGGGCATGACTGTGGCTGGTGTGGT

TCTGCTGGGCTCACTCTTCAGTCGGAAGTGACCAGACACTGACCGTCCACTCACCTCTCACCTCCCACCCTGCCCCCACCACAACTCTCTCTTCAGCCAC

CATTGCTACCAGGAGAACCACTACATGCAACTCACGCCCCTTGCCCTATCACAGGGTTGGGCCTAGACGGAGTCCCCTGCAATTAGCTTTCTAGGATCTA

CCACACTTCTGTGAAAGCCACCTTCCCCCCACATCTCAGTTCTCTTGGCCTCAAAACTCACAAGGTTTTCCCCTAAACCAGCTCCTTGGAGGCTGGCAGG

AGCAGAGAGGGGTGTGTGAGGGAGGAGAGCCTGTCTTGTTGGTGGGACCCTAATTACCCCTGAGCCTCTCGGGAATGCTTTTCCAGCAGGGAGCTCTTCC

CCTGAAGGAGACTAGCTTGCCTTGGTTTTGATGTGTGTGGCCTCAGACGTGATCATTTCCCATCCCGCTGTGTCTCTGGGTCTCCCTCCTCCCCATCTCC

ACCCCCCAAGAGCCATTGAGTGAGGTGCTTTTAGCCCTTTTGACTAATTAGAAATTCAGGCTGCTTGGGATAATGAGACAAGGACCAGAACCTCCTCCCC

ACCTGTGGCCTGGCCAAAACCCCCACTTGTGGTCTGAATGTTCTCCTGAGGCCTCTGGCTAGAGTCTAGCCCCACCCAGGGGGAGGGGCTTAGCTGCTGA

AAGTCCACCTTGCTAGAGCTAGGGTGGCTCTTGCAGCTTAGCACCCCCCAAGATCCTTGTCCACCCCTCCCCTGGCTCCCATGACCATGACTGAGGGACC

AATGGGCCCAAGATAGGTGCCCCAGAGCTGTTAATGACTTCAGCTGCCTCACTTCCTGCAAGATTGGCCTGTGGCATCTTTGCCTTGGGTGTTGGCCACA

GGGTCAAGGGACTCTGGCCTCAGCCCAGAAGTGAGGGGAAGCTATACAGAGCAGCTGTGGGAACCCCAGGGGCTTCCCTACCTCAGGCAGGAAGGGCAGG

AAGAAGAGCCTGGAGCCCAGGCGAGGGGGACGGCAAGGGCCTGTCTTTGTGCTCTGCCCCACCTAGCCTGGGCAGCAGGGCTGCCAAGGTCAGAATGGCC

TGGCTAGGAGCCCTTCAGGCCTCTCTCTCCTCTGTCCACCCTTGGCCTGTCTCATCCCTGTGGGTCCCAGCTCAGCTCTGGCCACCCCGGGCTCTCTGCT

GTACATATTCGAGACTAGTTTTTATTCCTTGTGAAGATGATATACTATTTTTGTTAAGCGTGTCTGTATTTATGTGTGAGGAGCTGCTGGCTTGCTGTGC

GCGTGCCCGTGGAGAGCTGGTGCCCAGAGACTGACAGCCTGATGCTCCCTCCCTGCCCTTGCCTGGGGAAGCCCACCAGGGGTTCTGGCTTCTGAGGGGC

ACCTGTCCCTCCTCTCCCCTCACCCTACACTTGTTCCAGCTCTTTGAAATAGTTTGTGTGAAGGTGAAAGTGCAGTTCAGTAATAAATGGTGTCTGTGAC

TCTGTGAA
Translation
 - UNI9897 - - UNI22643 - - UNI25321 - MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLAD

SPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQV

LVSRIASWMATYLNDHLEPWIQENGGW - UNI3494 - - UNI13038 - - UNI16383 - - UNI25321 - DTFVDLYGNNAAAESRKGQER

FNRWFLTGMTVAGVVLLGSLFSRK
Transcript ENSMUST00000049893
Sequence
CGGGTGGCTGGAGCCTGCGGAGCAGAGAGAGGCCGCCCTCGATCTGGTCGATGGAGGAACCAGGTTGTGAGGGGGCAGGTTCCTAAGCTTCGCAATTCCT

CTGTCGCCTTCTGAGCTGCCTACCAGGTCGCATGATCCCTCCGGCCGGGGCTGGTTTTTTTTTTTTTTTTTTTTTTTTGCTGAGTTACCGGCGACCCAGC

CACCACCTCCTCCCCGACCTATGATACAAAAGACCTTCCGGGGGTTGTACCTGCTTGCTGTCGCCGGAGATAGATTTGAAT - UNI22643 - - UNI

25321 - AACCTTATCTTGGCTTTGGATCCTGGAAGAGAATCGCTAAACACAGAGCAGACCCAGTAAGTGAGCAGGTGTTTTGGACAATGGACTGGTTG

AGCCCATCTCTATTATAAAAATGTCTCAGAGCAACCGGGAGCTGGTGGTCGACTTTCTCTCCTACAAGCTTTCCCAGAAAGGATACAGCTGGAGTCAGTT

TAGTGATGTCGAAGAGAATAGGACTGAGGCCCCAGAAGAAACTGAAGCAGAGAGGGAGACCCCCAGTGCCATCAATGGCAACCCATCCTGGCACCTGGCG

GATAGCCCGGCCGTGAATGGAGCCACTGGCCACAGCAGCAGTTTGGATGCGCGGGAGGTGATTCCCATGGCAGCAGTGAAGCAAGCGCTGAGAGAGGCAG

GCGATGAGTTTGAACTGCGGTACCGGAGAGCGTTCAGTGATCTAACATCCCAGCTTCACATAACCCCAGGGACCGCGTATCAGAGCTTTGAGCAGGTAGT

GAATGAACTCTTTCGGGATGGAGTAAACTGGGGTCGCATCGTGGCCTTTTTCTCCTTTGGCGGGGCACTGTGCGTGGAAAGCGTAGACAAGGAGATGCAG

GTATTGGTGAGTCGGATTGCAAGTTGGATGGCCACCTATCTGAATGACCACCTAGAGCCTTGGATCCAGGAGAACGGCGGCTGG - UNI3494 - - U

NI25321 - GAGACCTTCCTG
Translation
 - UNI22643 - - UNI25321 - MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSS

SLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATY

LNDHLEPWIQENGGW - UNI3494 - - UNI25321 - ETFL

For any suggestions or comments, please send an email to unitrap@crg.es