Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000007817 (Zmiz1)
Chromosomal location
Chr 14: 26278778 - 26484193 (+)
Description
zinc finger, MIZ-type containing 1 Gene [Source:MGI Symbol;Acc:MGI:3040693]
RefSeq_dna
NM_183208 
RefSeq_peptide
NP_899031.2 
UniGene
Mm.227484 
MGI
MGI:3040693 
Uniprot/SWISSPROT
Q6P1E1 
Human Ortholog
ENSG00000108175 (ZMIZ1)
Omim not available
UniTrap UNI18540
Vector Insertion
Chr 14: 26279043 - 26322140
Public Clones not available
Private Clones OST421061 (lexicon) OST367560 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32708
Vector Insertion
Chr 14: 26356311 - 26391505
Public Clones IST11767D9 (tigm) IST12647D7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35355
Vector Insertion
Chr 14: 26395731 - 26401053
Public Clones IST10884F11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25435
Vector Insertion
Chr 14: 26401160 - 26455358
Public Clones IST11084F7 (tigm) IST11518G11 (tigm) IST10070E10 (tigm) IST14378D6 (tigm)
IST14921D12 (tigm) IST14822D9 (tigm) IST14949D3 (tigm) IST14559C12 (tigm)
IST14946H6 (tigm) IST11028A3 (tigm) IST10487E3 (tigm) IST13851H12 (tigm)
IST12482E7 (tigm) IST14983C12 (tigm) IST10579E10 (tigm) IST10907A1 (tigm)
IST10996G8 (tigm) IST11747H6 (tigm) IST14609C12 (tigm) IST11025E8 (tigm)
IST10936H2 (tigm) IST10228D10 (tigm) IST11534H9 (tigm) IST10115E7 (tigm)
IST15087E8 (tigm) IST14285H11 (tigm) IST12083C5 (tigm) IST10034F10 (tigm)
IST14946G10 (tigm) IST11252F11 (tigm) IST12393C6 (tigm) IST10354B3 (tigm)
IST14822E8 (tigm) IST14806C2 (tigm) IST10077B9 (tigm) IST14782C11 (tigm)
IST12920D9 (tigm) IST10010B5 (tigm) IST14873F3 (tigm) IST11433B8 (tigm)
IST15104D2 (tigm) IST14794G11 (tigm) IST11076D9 (tigm) IST14715E12 (tigm)
IST13074H1 (tigm) IST10813A12 (tigm) IST11096F6 (tigm) IST12689E6 (tigm)
IST10036G11 (tigm) IST10758A8 (tigm) IST14329A4 (tigm) IST12524A1 (tigm)
IST14729G4 (tigm) IST12131G3 (tigm) IST12563F2 (tigm)
Private Clones OST183973 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25951
Vector Insertion
Chr 14: 26463159 - 26464141
Public Clones not available
Private Clones OST149456 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8374
Vector Insertion
Chr 14: 26470880 - 26471332
Public Clones XH746 (baygenomics) PST1761-1 (escells)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000007961
Sequence
GGACATTAAAAAAGCGAGCGGCGGCGGCGGCGGGCGCCCGGGAGAGCAAGCTGCCGGCCGGGCGAGCAGCGATCCGGCTGCAGAGCAAGCGAGCAGCGCC

CGCGCAGCGCGCTGACCCTAGCCCCGGCCGGTGAGGAGCCGGAGCCGGAGTCGGAGCCGAGTGGATTTCCGCGCTCTCGCTGCGCTCCTCCCGGCTCCAG

CCTGCCCTACACGGCGGTGGCGGCGGCGCGTCCTCCAGCGGTGGCAGTGGTGCTCGCAGCGCCCG - UNI18540 - GACTCAGACAGCATAGAATCT

ACTCAGCATCTCCTTCGCCACAGCCTCCCTTCCCCAACATCACATTAGCCTTGAGTTGTGATCGACTGGCAGGAGCCCTAGCAG GAGGATGGACCTTGA

GTGAAGTGGAAGAGCTGTGAGTGGCTGGCCAGCGCAGGAACACTAGTGTCTCTCGGCTCACTGAG - UNI32708 - GCTGGACCACGTTCATGGCTC

TCGGGTAGGACCCAGCGAAACGGCCAGAATGAATTCTATGGACAGGCACATCCAGCAGACCAATGACCGTCTGCAGTGCATCAAGCAG CACTTACAGAA

CCCCGCCAACTTCCACAATGCTGCTACAGAGCTGCTGGATTGGTGTGGAGACCCTCGAGCCTTCCAGAGGCCCTTTGAGCAGAGCCTCATGGGCTGCCTG

ACG GTTGTCAGCCGTGTGGCTGCCCAACAAGGGTTTGACCTGGACCTGGGCTACAGACTCTTGGCTGTGTGCGCCGCAAATCGAGACAAGTTCACCCCC

AAGTCTGCTG - UNI25435 - CCCTGCTGTCCTCCTGGTGTGAAGAACTTGGCCGCCTGCTGCTGCTGCGACATCAGAAGAGCCGCCAGAACGACCC

CCCTGGGAAACTGCCCATGCAGCCCCCCCTCAGCTCCATGAGCTCCATGAAACCCACTCTGTCGCACAG TGATGGGTCATTTCCTTATGACTCTGTCCC

TTGGCAGCAGAACACCAATCAGCCTCCCGGCTCCCTCTCCGTGGTCACCACGGTGTGGGGAGTGACCAACACATCCCAGAGTCAG - UNI25951 - G

TCCTCGGGAACCCTATGGCCAATGCCAACAACCCTATGAATCCAGGTGGCAACCCCATGGCATCAGGCATGAGCACCAGCAACCCCGGCATCAACTCCCC

ACAGTTCGCAGGGCAACAGCAACAGTTCTCCACCAAAGCTGGCCCTGCACAGCCCTATATCCAGCCCAACATGTACGGCCGACCTGGCTACCCTGGTAGC

GGGGGCTTTGGGGCCAG TTACCCTGGGGGTCCTAGTGCCCCAGCAGGCATGGGCATCCCTCCACATACTCGGCCTCCTGCTGACTTCACCCAGCCAGCG

GCCGCTGCTGCAGCAGCTGCAGTAGCAGCCGCCGCTGCCACAGCCACAGCCACAGCCACAGCTACAGTGGCAGCCTTGCAAGAGACACAGAACAAGGATA

TAAACCAGTATGGACCG GTGTGTTCCTCTTTCCAGATGGGTCCCACCCAGGCGTATAACAGCCAATTCATGAACCAACCCGGGCCTCGGGGGCCTGCCT

CCATGGGGGGCAGCCTGAACCCTGCCGGCATGGCAGCTGGCATGACACCCTCGGGCATGAGCGGCCCTCCCATGGGCATGAACCAGCCCCGACCACCCGG

CATCAGCCCCTTTGGCACACACGGGCAAAGGATGCCCCAGCAGACCTACCCAGGCCCCCGGCCCCAGTCCCTTCCTATTCAGAGCATAAAGAGGCCATAC

CCGGGAGAG CCCAACTATGGAAACCAGCAATATGGACCAAACAGCCAGTTCCCCACCCAGCCAGGCCAGTACCCTACCCCTAACCCCCCAAGGCCACTC

ACATCTCCCAACTACCCTGGACAAAGGATGCCGAGCCAACCCAGCACCGGACAGTACCCACCCCCCACAGTCAACATGGGGCAGTATTACAAG CCAGAA

CAGTTTAATGGACAGAACAACACCTTCTCCTCCGGAAGCAGCTACAGCAGCTACAGCCAAGGGAGCGTCAACAGG CCTCCCAGGCCGGTTCCTGTGGCG

AATTACCCCCACTCACCTGTTCCAGGGAACCCCACTCCCCCCATGACGCCCGGGAGCAGCATACCTCCCTATCTGTCCCCCAGCCAAGATGTCAAACCAC

CTTTCCCACCTGATATCAAGCCAAATATGAGTGCTCTGCCACCACCCCCAG - UNI8374 - CCAACCACAATGACGAGCTACGGCTCACATTCCCCG

TGCGGGATGGCGTGGTTCTGGAGCCCTTCCGCCTGGAGCACAACCTTGCCGTCAGCAACCACGTGTTCCACCTGCGGCCCACGGTTCATCAGACGCTGAT

GTGGAG GTCAGACCTGGAGCTGCAGTTCAAGTGCTACCACCATGAAGATCGACAGATGAACACCAACTGGCCAGCCTCGGTTCAGGTCAGCGTCAACGC

CACACCCCTCACGATCGAGCGGGGAGACAACAAGACCTCCCACAAGCCCCTGCACCTCAAGCATGTATGCCAGCCTGGCCGGAACACCATCCAGATCACT

GTCACCGCCTGCTGCTGT TCCCACCTCTTTGTGCTGCAGCTGGTACACCGGCCCTCTGTGCGCTCCGTGCTGCAGGGCCTCCTCAAGAAGCGCCTACTG

CCCGCTGAGCACTGCATCACGAAAA TCAAGCGGAATTTCAGCAGTGTGGCTGCCTCCTCGGGCAACACAACTCTCAATGGGGAGGATGGCGTGGAGCAG

ACCGCCATCAAGGTGTCTCTGAAGTGCCCCATCACATTCCGGCGCATACAGCTGCCTGCTCGAGGCCACGATTGCAAGCATGTGCAG TGCTTTGACCTG

GAGTCATACCTCCAACTGAATTGTGAGCGAGGGACCTGGAGGTGTCCCGTGTGCAA TAAAACTGCTCTGCTCGAGGGTCTGGAAGTGGATCAGTACATG

TGGGGGATCCTGAACGCCATCCAACA CTCCGAGTTTGAAGAGGTCACCATTGACCCCACGTGCAGCTGGCGGCCAGTACCCATCAAGTCAGACCTCCAC

ATCAAGGATGACCCCGATGGCATCCCCTCAAAGCGGTTCAAAACCATGAGCCCCAGCCAGATGATCATGCCCAATGTCATGGAGATGATCGCCGCTCTGG

GCCCTGGCCCGTCTCCCTACCCCCTCCCACCTCCTCCTGGGGGCACCAGCTCCAACGACTACAGCAGCCAAG GAAACAACTACCAGGGTCATGGCAACT

TTGACTTCCCCCATGGGAATCCCGGAGGGACATCCATGAACGACTTCATGCACGGTCCCCCCCAGCTCTCGCACCCACCGGACATGCCCAACAACATGGC

CGCCCTCGAGAAACCCCTCAGTCACCCCATGCAGGAAACT ATGCCCCACGCTGGCAGTTCTGACCAGCCCCATCCCTCCATACAACAAGGTTTGCACGT

ACCACACCCCAGCAGCCAGGCAGGGCCTCCATTACATCACAGTGGGGCTCCTCCTCCTTCCCAGCCTCCCCGGCAGCCACCACAGGCCGCTCCCGGCAAC

CATCCACACAGCGACCTGACCTTTAACCCCTCCTCAGCCTTAGAGGGTCAGGCCGGAGCACAGGGAGCATCCGACATGCCGGAACCTTCACTGGAT CTA

CTGCCGGAACTCACAAACCCGGATGAGCTTCTTTCCTACCTGGACCCCCCCGACCTTCCAAGCAATAGCAACGATGACCTCCTGTCTCTCTTTGAGAACA

ACTGAAGGCCACTCTCCACTGGGGCCATCCCTCCCCACTCTGCCTCCTACCCCATCTGTCCCACATCCTATTCCTCCCAGGAGCCCATGCTCAGGCCTCC

CACACCAGGACCTCAGGCTGAGAGCTGAGCAGAGCACACTAGGCAGGGAAAGCCATGTGGGTCTCCAGTCCTGTTTGCCTGAATGCTCTGGGATCTATGC

CTAGAGCAAGCCTGAAGACGGCCCCTGGAAGACAAACCCAAGCTGAGGGAATCCAGGCCCAGCAAGAGACATGCCAATGGCGACTGTAGGTCCCTCCATG

TGTGCTGACTCCAGACAACCGACCTTCCAGTGTCCCAAAGTTCTTCCATGTTTTTAAACCTTATCCCCGCCTCTTGGCCCAGAGCCTCCTTCAGATGACT

GGAACCCGAAAGAAGCCTGTGCTCCGGCCCCCAGGCCAGGGTAGTGGACAAGCCTTGGAGGAGTGGTGACAGTTTGCAGCAGTGAGGAAGGACACGCACA

CACACACACACACACCACAGAAAAGCACAACCCTCTGGGGAGGAGACCATCCCTCAAGGCCGGGGGTCGTGGCTTTGGCCTCTGACTTCTAAGCCAAGAT

GCCCTGTAAACACTCTCTCAGCAGAACAAGGACAAAGTGCCGTGTCTGAGAGAGAGTGCCACACCTTGTAGGGACTGGCAGGAAACAGGTCAGGGCCTTC

CCCAGAGCCAAGACAATGCAGAGGAGGGCTCCTTAACTCAGACCAGGGCCATGCCTTGCGGGGAGCAGAGAGTGTGTGCACCACACCAAAGGGAGCCCTC

CGTTAGTTAGAGGCCAGAGGACGATGCCAGCCAGAGCCCCACAGAAGCAGCCAGGGCCTTGCAGCTTTGCCCCAAGCCAATCCCTGCTTTTAAATGACCC

GCAGCGGGGAGCTCTGAAGAAGGAGCTCTGAAGGAAAGGAACATTGTATCTGGACAGCAAGCAAGCCATTTCCCCCCATGTTCTCTTTCCTTCCTCCTAC

CCATACTTCCTTCTCTGAGACTATTCCATGGGACCCACTTCCCTCTGGGTTCTCCTTTCCCCAGACAGCTGTAGGGGCACATGGTAGGGAAGCAGCATAG

GCCCCCAGGGAAACGACTCCACAGCAGGGCCTTCATGGATCTCCAAGTCTCTCAGTCTGGTCCAGCAGGTTCTCTGCTCAAAGCTGCCTGTCTCCAGCCC

AGACCTTTGCTGGGTGCACCAGAGCATCTCAGCAGGCAGGCATTTTGTGGCATTTATGGCCTGTCACTCCCTGTATTTCTCCCTCCATCCAGAGCTCGCT

CCACACTCCTGCTCACCCAGCAAGTGCAGCCTCTGGCCCTCCTCTGCTTTTTCACTCCATCCAGCTTAGAGTCCCCTGCTGGCTTGTCACTCGCCTGCTT

TGTGCCAGGCTGGTCTGTGTCCCCCTGAGCCTCATGGCCTACGGTGATGCCTGTGGTGATGCCAGGTTGTCCGCTCACATGAGTCCCATCTGTAAATTCT

TTGCTCCCTTCTCCGATGCTGCCACCCAAGGCCTTCTCCTGCCTCCTGTCCACTGCCAGCGTCCTCATTTGTCATCGGTCATTAGCCTCCCTCTGTGCTC

CCTGGCACTCTTAATATAGATTGAACCAGAAAGGTGACCCCTAGCTGTTGACTTATTGTCACCCT
Translation
 - UNI18540 -   - UNI32708 - MNSMDRHIQQTNDRLQCIKQ HLQNPANFHNAATELLDWCGDPRAFQRPFEQSLMGCLT VVSRVAAQQGF

DLDLGYRLLAVCAANRDKFTPKSAA - UNI25435 - ALLSSWCEELGRLLLLRHQKSRQNDPPGKLPMQPPLSSMSSMKPTLSHS SDGSFPYDSVP

WQQNTNQPPGSLSVVTTVWGVTNTSQSQ - UNI25951 - VLGNPMANANNPMNPGGNPMASGMSTSNPGINSPQFAGQQQQFSTKAGPAQPYIQPNM

YGRPGYPGSGGFGAS SYPGGPSAPAGMGIPPHTRPPADFTQPAAAAAAAAVAAAAATATATATATVAALQETQNKDINQYGP VCSSFQMGPTQAYNSQ

FMNQPGPRGPASMGGSLNPAGMAAGMTPSGMSGPPMGMNQPRPPGISPFGTHGQRMPQQTYPGPRPQSLPIQSIKRPYPGE PNYGNQQYGPNSQFPTQP

GQYPTPNPPRPLTSPNYPGQRMPSQPSTGQYPPPTVNMGQYYK PEQFNGQNNTFSSGSSYSSYSQGSVNR PPRPVPVANYPHSPVPGNPTPPMTPGSS

IPPYLSPSQDVKPPFPPDIKPNMSALPPPPA - UNI8374 - ANHNDELRLTFPVRDGVVLEPFRLEHNLAVSNHVFHLRPTVHQTLMWR RSDLELQ

FKCYHHEDRQMNTNWPASVQVSVNATPLTIERGDNKTSHKPLHLKHVCQPGRNTIQITVTACCC SHLFVLQLVHRPSVRSVLQGLLKKRLLPAEHCITK

I IKRNFSSVAASSGNTTLNGEDGVEQTAIKVSLKCPITFRRIQLPARGHDCKHVQ CFDLESYLQLNCERGTWRCPVCN NKTALLEGLEVDQYMWGIL

NAIQH HSEFEEVTIDPTCSWRPVPIKSDLHIKDDPDGIPSKRFKTMSPSQMIMPNVMEMIAALGPGPSPYPLPPPPGGTSSNDYSSQG GNNYQGHGNF

DFPHGNPGGTSMNDFMHGPPQLSHPPDMPNNMAALEKPLSHPMQET MPHAGSSDQPHPSIQQGLHVPHPSSQAGPPLHHSGAPPPSQPPRQPPQAAPGN

HPHSDLTFNPSSALEGQAGAQGASDMPEPSLD LLPELTNPDELLSYLDPPDLPSNSNDDLLSLFENN

For any suggestions or comments, please send an email to unitrap@crg.es