Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000007827 (Ankrd26)
Chromosomal location
Chr 6: 118452582 - 118512274 (-)
Description
ankyrin repeat domain 26 Gene [Source:MGI Symbol;Acc:MGI:1917887]
RefSeq_dna
NM_001081112 
RefSeq_peptide
NP_001074581.1 
UniGene
Mm.276116 
MGI
MGI:1917887 
Uniprot/SWISSPROT
Q811D2 
Uniprot/SPTREMBL
Q8BUI6 
Human Ortholog
not available
Omim not available
UniTrap UNI9081
Vector Insertion
Chr 6: 118498331 - 118498394
Public Clones XK096 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9106
Vector Insertion
Chr 6: 118472012 - 118472956
Public Clones XK525 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6395
Vector Insertion
Chr 6: 118468008 - 118468358
Public Clones YHC037 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000088758
Sequence
AGCAAGAAGGCGCGGGTTGCTAGTTTGCAGCTCGGCTTGGCGATTATTGTGCTTTAAAAACCTGCCGGGCCATGCAGCGTCTTTCCCGGTGGGATCCCGT

GCGTCTAGGCCGGCTTTTCAATAAGTGCCCTAGCTGCGTTGTGTTGTCAGCCAACGTTGCGCGGGGAAGAAGGTGCCTGTGAGGGGCGTACCCTCTGCCA

TGAAGAAGATTTTTGGCTTCAGGAGTAAGGGCCCATCGCCCTTAGGCCCCTCTGCCCGCCCGCGCAGCAACTGCGTGGGCTTTGGACGCGAGAGTGCTAG

TGGCTCCCACGTGCCCAGGTACCATATTCACGACAAGGATATGGGCAAGATCCACAAGGCTGCAAGCGTGGGAGATGTAGCCAAAGTGCAGCATATCCTT

ATCCTTGGAAAAAGTGGCGTGAACGATAGAGACAAGAAGGACAG GACTGCTCTACATCTTGCCTGTGCTTACGGCCACCCAGAAGTGGTGACTCTCTTA

GTAGAGAGAAAATGTGAGATAGATGCCCGTGACAGCGAGAGCAGCACGGCCCTCATTAAG GCCGTGCAGTGCCAGGAGGAAGAATGTGCAGCCATACTG

CTGGACCACGGGGCCGATCCAAATGTGATGGACAGCAGCGGCAACACCGCCCTCCACTACGCGGTCTACAGTGAGAACACGTCCATGGCAGCCAAACTGC

TCGCACACAATGCAAACATAGAAGCCAAAAACAAG GATGACCTAACACCTATGTTACTTGCTGTAAAGGAAAATAAACAACATATTGTGGAATTTTTAG

TAAAGAAGAAAGCAAGTATTCACGCAGTTGATCAGCTTGGAAG CAACAGGCAAATGTTTGAATATGATGGGAAGAGACTACAAAGATCTGAAAACAGCA

ATCCAG TGGATAATGGTTCTGAAGATGGCTCTTTAACCAG GTCTTATAACACACCTGGCCCTGCTGATTCCTGGCCGACATCAGATGAGGAGGACTAT

AACTTTGACAACAAG AATGTCCCCAAAATTAATTTGACAGAGTTGTGGACAGCTGCTCAGCAGTCTAGGAAAAACC AAACAAAATGTGGCTTTGAGGA

GCTAGACAATGGAGCCCGGTTTGATGACAGTGATTCCCCTAGTGAAAGTGAAGATGCCATTGAGGTTGAGCCT CGCCATCAGTCAGAGTCCAGACCCTC

TCCCCATCCCGTCAGTCACCTGACCCTGTG GAAGGAGCAACCGAGCTAGCAATTGAAGGAGAAGAAAACGGTACTGATGTTATTGAGAGCGCTTCACAG

GAGCAACCAAATCATGACAATTTAACCCGTGCTGATGGTTGGCACAAAAGTAATAAAAGTG - UNI9081 - AAATGATGTCTGCATTAGGATTAGGA

GAAGACGAAGATGAACACTCGCCTTGGGATTCTGAG - UNI9081 - AGTATCTCCGAGAGTGTGTCACTGAAAGACGTAGGTCACTTCTCTGGGACT

GCAGATCAAACGGGAAAAAGGAGAGCACATGGACAGATAGAAG ATGTGACTTATATACCTTCTTGCATGAGTGGATCAAGAAGCTTTAAAATGGCTAAA

CTAGAGGAGTCAAGAAATGTAGGCCTTCCGGTAGCCCACATGG AGGCCCCCAGGAAATATGCAATCATGGAG CCTACCATCGAAAGGAGGGCTCCTGT

TCTGAACAAAACGGAGACAGTGGGAATGACGGATGCACAGACTTTCAAGTCAG AGCCAGAATCAGTATCAAGAGAAGAACAGACAAGGCTCAGTGGCAG

CGAGGACAGCCAGCAGAAG GTTGAAGAAAAGAGAAAATACAAAAATAACGAAGCAGAACCCTCAGGAAATCTATACAGCGGTGCTGCTGACGGCGGTGC

TGATGTAAAGCCACAGAGTGGAGACACTGAGAACCAGCAGTCTCCCCGGGAGGGGAGTGAGGGACGTGGCAG TGGTCCTGCCTTGCTTATGAAGGAAGC

AAAGAAAATGGAAAATGAAAAATGGGTATCCAGAGAGCCCGCGAGGACGGCAATGAGTGAGCGCACCGGCTTACCAACTGGTGGCTGGCCACAAATGCAG

GATGGTTCCTGCTGGAGTGACACGGACCAAAGTGAAGCCAG GCCCACAAAGAAAACATCTAGTAAACATAACAAG GACAGCGGGCAGACAGCTGCAGT

GGACAACCTTGACGACTTTACTGAGTCGTCTGAAACAGCCTCTGAGGACCATGAGCTCCAGGGCCCTGATTCCGAGAGCATTTTGTGTGCGATCGAGCAT

CTCAGACTGGAGTGTAAAG ATACTGCTAGTCTATTGAAAATCCGGGATGCCGTTTATTCATATAAACGATTAATAGAACTTAAAAGAAGCCACTGTGAA

CTACTTACAGGAAAACTGAAAAGAATGGAAAACAAATATAAGGGATTGCAGAAGGAAATGTCAGAGACAGAAGAAGTGAAGTCACGGTTGGAACATGAAA

AGGTCGGATGGGAACAGGAGCTCTGCAGGCTGAG ATTTGCACTGAAACAAGAGGAAGAGAAGAGGAGGAGTGCAGACCAGCTTTCTGAGAAAACCTCGG

AGCAGCTTAGAAGGAAAGGCGAGCAGTGTCAGAGTGAGGTGGAAGCCAGGCAGCAGCTTGAAGCCTCTCTCAGAACCCTGGAGATGGAGCTGAAGACGGT

GAAAAGCCATCTCAACCAG GTCTTAGAGGAACGAAATGAGACTCAGAGGCAGCTCTCCCGAGAACAGAATGCCAGAATGTTACAAGATGGGATTCTTGC

AAGTCACCTCTGCAAGCAAAAGGAGATAGAAATGACGCAGAAGAAAATGACTTCTGAG GTTTCTGTTAGTCATGAAAAAGAAAAAGATCTATTGCATAA

AAACCAGAGGCTGCAGGATGAAGTTGCTGTGTTACGACTGGAAATGGACACAATAAAAAGCCATAACCAGGAGAAGGAAAAGAGGTATCTTGAGGATATT

AAGATTGCAAATGAGAAGAATGACAACCTTCAAAGGATGGTCAAGCTGAATGAAGAAACATTTACAAAAACCATATTCCAGTATACTGGACAGCTTAATA

GTCTTAAAGCTGAGAACACAATGCTGAGTTCTAAGCTGGACAACGAAAAACAAAATAAGGAGAGACTGGAAACAGACGTTGAGTCGTTCCGATCTAGGCT

GGCTTCTGCTCTGCATGATCACGCTGAAATTCAGACAGCAAAAAGAGACCTAGAAATTGCTTTCCAGAGAGCGAGAGATGAGTGGTTTCGTGTGAAAGAC

AAGATGAATTTCGATATGTCTAACCTCCGAGATAACAATGAGGTTCTCTCCCAACAGCTTTCTAAAACTGAAAGGAAGTTGAATAGCCTAGAAATTGAGT

TTCATCACACGAAAGATGAGCTTCGAGAGAAGACGCTGGCGTTAAAGCATGCGCAGAGAGACCTGAGCCAGACCCAGTGCCAGATGAAGGAGGTGGAGCA

CATGTTTCAGGACGAACAAGGCAAAGTGAGCAAGTTCATGGGGAAGCAGGAGTCCATAGAGGAGAGGCTGGCCCAGCTGCAGAGTGAGAACACGCTGCTC

CGGCAGCAGCTGGACGACGCTGCCAACAAGGCCGAGAGCAAAGACAAGACCATAGTCAACATCCAAGACCAGTTCCAGGATGTGCTAACCAGGTTCCAAG

CTGAGAGTCAGCGGCACAGCCTGAGGCTAGAAGACAGAAACCAGGAGTTAGTCAGTGAGTGCAGCCATCTAAGAGAAAGACTGTGTCAGTACGAGAACGA

GAAAGCCGAAAGAGAG - UNI9106 - GTAGTTGTGAGGCAACTCCAGCAAGAATTGGCTGATACCCTAAAAAAGCAGTCGATGTCAGAGGCTTCGCT

GGAAGTCTCCTCCCGCTACCGCAGCAATTTAGAAGAAGAGGCGCGAGACTTAAAGAAGAAATTAGGTCAGCTCAGAAGTCAG TTGCAGGAGGCGCGGGA

TCAACACAGAGAGGCTGTACACCATGCTGAGAAGATGGAAGACCACCTACAAAA - UNI6395 - GCTTGAACTTGAAAAATCCAAGTTCGAAATTAC

AATTAAAAAGCAATCAGAGGAAATTGATCAACTTCAGGAAAACCTGTCAAGGGTGAATTTG TCTGAAGAGGATAAGGAAAAACTGCAGAAACTTACCGA

GTTGAAGGAGTCTCTGGAATGTACTGTGGATCAAGAACAGAAGAGAAGCAGTGCGTTAGAAAAAGAACTGGCAGA ATTTAAGGAAGTCTTAAAAATGAC

CAAAAAAGAATTAAATGAATATGAAAACAGAGAACTTAATCTTCGTCAAGATATAAAAAACAATCACCTTGAAATGGATATCCCAGTTAGTACACTAATA

AAAAAG ATTGATGATCTTACAGCAAAACTGGAAACTGCATCTTCAAAATGTCTACATCTGGGTAAAAAAAATCAGCTGCTTCAGCAGGAGTTACTATTG

ATGAGGACTATACAAAAGAAGTGTGGGAAACTAGAGAAGAATAAAAAGCAATTGGAGCAGGAGGTCGTGAACCTCAGAAGTCACATGGAGAAGAACATGG

TGGAGCACAGCCAAGCACAGCAGTACGCGCGGGAGGTCGAAGAGCGAGCGAGGCAGGACTTGGTGGAAAAGTTAAAACAGGTCAACCTCTTCCTGCAG G

CTCAAGCAGCATCCCAGGAGAGCTTGGAGCAGTTAAGAGAGAACAGTAACGCTTCGGTTAGAAGTCAGATGGAGCTCAGGATTAAAGACCTGGAGTCCCA

GCTCTACAGAATGAAAGCCCAGGAAGACTTCGATAAAATAGAACTGGAAAAGTATAAGCAGCTCTACCAGGAAGAGTTCAGAGCTAGAAAATCGCTGTCA

AGTAAACTAAACAA GACCAGTGAGAAGCTGGAGGAGGCCAGCAGCAAGCTGCTCCTGGAGGAGCAGCAGAACAGGTCCTTGCTGAGCACTCTGAGTACA

AGGCCTGTTGTGGAGTGTCCTTGTGTTGGAAGTTTCCATAATAGTTTGGTATTCAACAGAACTCTTATTCCAAGAGAAAACATAGTGGTTCCTACTTCAG

GCCTACAGCCATCAAATAAGAGAGTGGAGATCTACCTGACCAAG ATGCATCAAGAGTTGGAAAAAAGTATAAATAGAGAACTTAAAGAAG CTACTGCT

GAACTTGAATCTGAGTTCTGCAGAGTTTCTCCCCTGGGATCTGCTACTAAAGCAAGCCAAGATCAACTCTCAGACGCATCGCAAGAATTTATAGACATTC

TAAAGAAAAAATATATGATCTGCTGAATTTAAAAAGAGAAAAAGGAAGAAAAAGTAGAAGTGGGACTTTTTGGGAGAGAGGATCAGAGAAGTTAAAGGGG

CACGTGCTGTGTGTCTGAAATGTCTCCGTGGCCTGGGTGTGGTGGCACGTGTCTTTGACTCCAGCACTTGGGAAGCAGAGGCTGGTAGATCTCTGAATTC

AAGGGCAGTCAGAGCTACATGTCTCATACTGAAAAATAAAGTCATAATGGAACCTACTATTTTGTACAAATAATACACATTAATATACATGATCTAAAAT

ATAACATTTTGGGCTGGAAAGGTGCCTCAGGAGTTTGAGAGCACTGGCAGCTCTTCCCTAGGTCCTGAATTCAGTTCCCAGCATCCATATGGTGGCTCTA

ACCATCTATAATGTGATCTGGTGTCCTCTTTTGATGTGCAGGATTATGTGCAAATAGAACACTCATATTCATAAAATAAATCTTT
Translation
MKKIFGFRSKGPSPLGPSARPRSNCVGFGRESASGSHVPRYHIHDKDMGKIHKAASVGDVAKVQHILILGKSGVNDRDKKDR RTALHLACAYGHPEVVT

LLVERKCEIDARDSESSTALIK AVQCQEEECAAILLDHGADPNVMDSSGNTALHYAVYSENTSMAAKLLAHNANIEAKNK DDLTPMLLAVKENKQHIV

EFLVKKKASIHAVDQLGS SNRQMFEYDGKRLQRSENSNPV VDNGSEDGSLTR RSYNTPGPADSWPTSDEEDYNFDNK NVPKINLTELWTAAQQSRK

NQ QTKCGFEELDNGARFDDSDSPSESEDAIEVEP RHQSESRPSPHPVSHLTLW WKEQPS - UNI9081 -  - UNI9081 -             

 - UNI9106 -   - UNI6395 -        
Transcript ENSMUST00000007971
Sequence
AGCAAGAAGGCGCGGGTTGCTAGTTTGCAGCTCGGCTTGGCGATTATTGTGCTTTAAAAACCTGCCGGGCCATGCAGCGTCTTTCCCGGTGGGATCCCGT

GCGTCTAGGCCGGCTTTTCAATAAGTGCCCTAGCTGCGTTGTGTTGTCAGCCAACGTTGCGCGGGGAAGAAGGTGCCTGTGAGGGGCGTACCCTCTGCCA

TGAAGAAGATTTTTGGCTTCAGGAGTAAGGGCCCATCGCCCTTAGGCCCCTCTGCCCGCCCGCGCAGCAACTGCGTGGGCTTTGGACGCGAGAGTGCTAG

TGGCTCCCACGTGCCCAGGTACCATATTCACGACAAGGATATGGGCAAGATCCACAAGGCTGCAAGCGTGGGAGATGTAGCCAAAGTGCAGCATATCCTT

ATCCTTGGAAAAAGTGGCGTGAACGATAGAGACAAGAAGGACAG GACTGCTCTACATCTTGCCTGTGCTTACGGCCACCCAGAAGTGGTGACTCTCTTA

GTAGAGAGAAAATGTGAGATAGATGCCCGTGACAGCGAGAGCAGCACGGCCCTCATTAAG GCCGTGCAGTGCCAGGAGGAAGAATGTGCAGCCATACTG

CTGGACCACGGGGCCGATCCAAATGTGATGGACAGCAGCGGCAACACCGCCCTCCACTACGCGGTCTACAGTGAGAACACGTCCATGGCAGCCAAACTGC

TCGCACACAATGCAAACATAGAAGCCAAAAACAAG GATGACCTAACACCTATGTTACTTGCTGTAAAGGAAAATAAACAACATATTGTGGAATTTTTAG

TAAAGAAGAAAGCAAGTATTCACGCAGTTGATCAGCTTGGAAG CAACAGGCAAATGTTTGAATATGATGGGAAGAGACTACAAAGATCTGAAAACAGCA

ATCCAG TGGATAATGGTTCTGAAGATGGCTCTTTAACCAG GTCTTATAACACACCTGGCCCTGCTGATTCCTGGCCGACATCAGATGAGGAGGACTAT

AACTTTGACAACAAG AATGTCCCCAAAATTAATTTGACAGAGTTGTGGACAGCTGCTCAGCAGTCTAGGAAAAACC AAACAAAATGTGGCTTTGAGGA

GCTAGACAATGGAGCCCGGTTTGATGACAGTGATTCCCCTAGTGAAAGTGAAGATGCCATTGAGGTTGAGCCTGCGCCATCAGTCAGAGTCCAGACCCTC

TCCCCATCCCGTCAGTCACCTGACCCTGTG GAAGGAGCAACCGAGCTAGCAATTGAAGGAGAAGAAAACGGTACTGATGTTATTGAGAGCGCTTCACAG

GAGCAACCAAATCATGACAATTTAACCCGTGCTGATGGTTGGCACAAAAGTAATAAAAGTG - UNI9081 - AAATGATGTCTGCATTAGGATTAGGA

GAAGACGAAGATGAACACTCGCCTTGGGATTCTGAG - UNI9081 - AGTATCTCCGAGAGTGTGTCACTGAAAGACGTAGGTCACTTCTCTGGGACT

GCAGATCAAACGGGAAAAAGGAGAGCACATGGACAGATAGAAG ATGTGACTTATATACCTTCTTGCATGAGTGGATCAAGAAGCTTTAAAATGGCTAAA

CTAGAGGAGTCAAGAAATGTAGGCCTTCCGGTAGCCCACATGG AGGCCCCCAGGAAATATGCAATCATGGAG CCTACCATCGAAAGGAGGGCTCCTGT

TCTGAACAAAACGGAGACAGTGGGAATGACGGATGCACAGACTTTCAAGTCAG AGCCAGAATCAGTATCAAGAGAAGAACAGACAAGGCTCAGTGGCAG

CGAGGACAGCCAGCAGAAG GTTGAAGAAAAGAGAAAATACAAAAATAACGAAGCAGAACCCTCAGGAAATCTATACAGCGGTGCTGCTGACGGCGGTGC

TGATGTAAAGCCACAGAGTGGAGACACTGAGAACCAGCAGTCTCCCCGGGAGGGGAGTGAGGGACGTGGCAG TGGTCCTGCCTTGCTTATGAAGGAAGC

AAAGAAAATGGAAAATGAAAAATGGGTATCCAGAGAGCCCGCGAGGACGGCAATGAGTGAGCGCACCGGCTTACCAACTGGTGGCTGGCCACAAATGCAG

GATGGTTCCTGCTGGAGTGACACGGACCAAAGTGAAGCCAG GCCCACAAAGAAAACATCTAGTAAACATAACAAG GACAGCGGGCAGACAGCTGCAGT

GGACAACCTTGACGACTTTACTGAGTCGTCTGAAACAGCCTCTGAGGACCATGAGCTCCAGGGCCCTGATTCCGAGAGCATTTTGTGTGCGATCGAGCAT

CTCAGACTGGAGTGTAAAG ATACTGCTAGTCTATTGAAAATCCGGGATGCCGTTTATTCATATAAACGATTAATAGAACTTAAAAGAAGCCACTGTGAA

CTACTTACAGGAAAACTGAAAAGAATGGAAAACAAATATAAGGGATTGCAGAAGGAAATGTCAGAGACAGAAGAAGTGAAGTCACGGTTGGAACATGAAA

AGGTCGGATGGGAACAGGAGCTCTGCAGGCTGAG ATTTGCACTGAAACAAGAGGAAGAGAAGAGGAGGAGTGCAGACCAGCTTTCTGAGAAAACCTCGG

AGCAGCTTAGAAGGAAAGGCGAGCAGTGTCAGAGTGAGGTGGAAGCCAGGCAGCAGCTTGAAGCCTCTCTCAGAACCCTGGAGATGGAGCTGAAGACGGT

GAAAAGCCATCTCAACCAG GTCTTAGAGGAACGAAATGAGACTCAGAGGCAGCTCTCCCGAGAACAGAATGCCAGAATGTTACAAGATGGGATTCTTGC

AAGTCACCTCTGCAAGCAAAAGGAGATAGAAATGACGCAGAAGAAAATGACTTCTGAG GTTTCTGTTAGTCATGAAAAAGAAAAAGATCTATTGCATAA

AAACCAGAGGCTGCAGGATGAAGTTGCTGTGTTACGACTGGAAATGGACACAATAAAAAGCCATAACCAGGAGAAGGAAAAGAGGTATCTTGAGGATATT

AAGATTGCAAATGAGAAGAATGACAACCTTCAAAGGATGGTCAAG AACACAATGCTGAGTTCTAAGCTGGACAACGAAAAACAAAATAAGGAGAGACTG

GAAACAGACGTTGAGTCGTTCCGATCTAGGCTGGCTTCTGCTCTGCATGATCACGCTGAAATTCAGACAGCAAAAAGAGACCTAGAAATTGCTTTCCAGA

GAGCGAGAGATGAGTGGTTTCGTGTGAAAGACAAGATGAATTTCGATATGTCTAACCTCCGAGATAACAATGAGGTTCTCTCCCAACAGCTTTCTAAAAC

TGAAAGGAAGTTGAATAGCCTAGAAATTGAGTTTCATCACACGAAAGATGAGCTTCGAGAGAAGACGCTGGCGTTAAAGCATGCGCAGAGAGACCTGAGC

CAGACCCAGTGCCAGATGAAGGAGGTGGAGCACATGTTTCAGGACGAACAAGGCAAAGTGAGCAAGTTCATGGGGAAGCAGGAGTCCATAGAGGAGAGGC

TGGCCCAGCTGCAGAGTGAGAACACGCTGCTCCGGCAGCAGCTGGACGACGCTGCCAACAAGGCCGAGAGCAAAGACAAGACCATAGTCAACATCCAAGA

CCAGTTCCAGGATGTGCTAACCAGGTTCCAAGCTGAGAGTCAGCGGCACAGCCTGAGGCTAGAAGACAGAAACCAGGAGTTAGTCAGTGAGTGCAGCCAT

CTAAGAGAAAGACTGTGTCAGTACGAGAACGAGAAAGCCGAAAGAGAG - UNI9106 - GTAGTTGTGAGGCAACTCCAGCAAGAATTGGCTGATACC

CTAAAAAAGCAGTCGATGTCAGAGGCTTCGCTGGAAGTCTCCTCCCGCTACCGCAGCAATTTAGAAGAAGAGGCGCGAGACTTAAAGAAGAAATTAGGTC

AGCTCAGAAGTCAG TTGCAGGAGGCGCGGGATCAACACAGAGAGGCTGTACACCATGCTGAGAAGATGGAAGACCACCTACAAAA - UNI6395 - G

CTTGAACTTGAAAAATCCAAGTTCGAAATTACAATTAAAAAGCAATCAGAGGAAATTGATCAACTTCAGGAAAACCTGTCAAGGGTGAATTTG TCTGAA

GAGGATAAGGAAAAACTGCAGAAACTTACCGAGTTGAAGGAGTCTCTGGAATGTACTGTGGATCAAGAACAGAAGAGAAGCAGTGCGTTAGAAAAAGAAC

TG ATGAGGACTATACAAAAGAAGTGTGGGAAACTAGAGAAGAATAAAAAGCAATTGGAGCAGGAGGTCGTGAACCTCAGAAGTCACATGGAGAAGAACA

TGGTGGAGCACAGCCAAGCACAGCAGTACGCGCGGGAGGTCGAAGAGCGAGCGAGGCAGGACTTGGTGGAAAAGTTAAAACAGGTCAACCTCTTCCTGCA

G GCTCAAGCAGCATCCCAGGAGAGCTTGGAGCAGTTAAGAGAGAACAGTAACGCTTCGGTTAGAAGTCAGATGGAGCTCAGGATTAAAGACCTGGAGTC

CCAGCTCTACAGAATGAAAGCCCAGGAAGACTTCGATAAAATAGAACTGGAAAAGTATAAGCAGCTCTACCAGGAAGAGTTCAGAGCTAGAAAATCGCTG

TCAAGTAAACTAAACAA GACCAGTGAGAAGCTGGAGGAGGCCAGCAGCAAGCTGCTCCTGGAGGAGCAGCAGAACAGGTCCTTGCTGAGCACTCTGAGT

ACAAGGCCTGTTGTGGAGTGTCCTTGTGTTGGAAGTTTCCATAATAGTTTGGTATTCAACAGAACTCTTATTCCAAGAGAAAACATAGTGGTTCCTACTT

CAGGCCTACAGCCATCAAATAAGAGAGTGGAGATCTACCTGACCAAG ATGCATCAAGAGTTGGAAAAAAGTATAAATAGAGAACTTAAAGAAG CTACT

GCTGAACTTGAATCTGAGTTCTGCAGAGTTTCTCCCCTGGGATCTGCTACTAAAGCAAGCCAAGATCAACTCTCAGACGCATCGCAAGAATTTATAGACA

TTCTAAAGAAAAAATATATGATCTGCTGAATTTAAAAAGAGAAAAAGGAAGAAAAAGTAGAAGTGGGACTTTTTGGGAGAGAGGATCAGAGAAGTTAAAG

GGGCACGTGCTGTGTGTCTGAAATGTCTCCGTGGCCTGGGTGTGGTGGCACGTGTCTTTGACTCCAGCACTTGGGAAGCAGAGGCTGGTAGATCTCTGAA

TTCAAGGGCAGTCAGAGCTACATGTCTCATACTGAAAAATAAAGTCATAATGGAACCTACTATTTTGTACAAATAATACACATTAATATACATGATCTAA

AATATAACATTTTGGGCTGGAAAGGTGCCTCAGGAGTTTGAGAGCACTGGCAGCTCTTCCCTAGGTCCTGAATTCAGTTCCCAGCATCCATATGGTGGCT

CTAACCATCTATAATGTGATCTGGTGTCCTCTTTTGATGTGCAGGATTATGTGCAAATAGAACACTCATATTCATAAAATAAATCTTT
Translation
MKKIFGFRSKGPSPLGPSARPRSNCVGFGRESASGSHVPRYHIHDKDMGKIHKAASVGDVAKVQHILILGKSGVNDRDKKDR RTALHLACAYGHPEVVT

LLVERKCEIDARDSESSTALIK AVQCQEEECAAILLDHGADPNVMDSSGNTALHYAVYSENTSMAAKLLAHNANIEAKNK DDLTPMLLAVKENKQHIV

EFLVKKKASIHAVDQLGS SNRQMFEYDGKRLQRSENSNPV VDNGSEDGSLTR RSYNTPGPADSWPTSDEEDYNFDNK NVPKINLTELWTAAQQSRK

NQ QTKCGFEELDNGARFDDSDSPSESEDAIEVEPAPSVRVQTLSPSRQSPDPV EGATELAIEGEENGTDVIESASQEQPNHDNLTRADGWHKSNKSE 

- UNI9081 - EMMSALGLGEDEDEHSPWDSE - UNI9081 - SISESVSLKDVGHFSGTADQTGKRRAHGQIED DVTYIPSCMSGSRSFKMAKLE

ESRNVGLPVAHME EAPRKYAIME PTIERRAPVLNKTETVGMTDAQTFKSE EPESVSREEQTRLSGSEDSQQK VEEKRKYKNNEAEPSGNLYSGAAD

GGADVKPQSGDTENQQSPREGSEGRGS SGPALLMKEAKKMENEKWVSREPARTAMSERTGLPTGGWPQMQDGSCWSDTDQSEAR RPTKKTSSKHNK D

SGQTAAVDNLDDFTESSETASEDHELQGPDSESILCAIEHLRLECKD DTASLLKIRDAVYSYKRLIELKRSHCELLTGKLKRMENKYKGLQKEMSETEE

VKSRLEHEKVGWEQELCRLR RFALKQEEEKRRSADQLSEKTSEQLRRKGEQCQSEVEARQQLEASLRTLEMELKTVKSHLNQ VLEERNETQRQLSREQ

NARMLQDGILASHLCKQKEIEMTQKKMTSE VSVSHEKEKDLLHKNQRLQDEVAVLRLEMDTIKSHNQEKEKRYLEDIKIANEKNDNLQRMVK NTMLSS

KLDNEKQNKERLETDVESFRSRLASALHDHAEIQTAKRDLEIAFQRARDEWFRVKDKMNFDMSNLRDNNEVLSQQLSKTERKLNSLEIEFHHTKDELREK

TLALKHAQRDLSQTQCQMKEVEHMFQDEQGKVSKFMGKQESIEERLAQLQSENTLLRQQLDDAANKAESKDKTIVNIQDQFQDVLTRFQAESQRHSLRLE

DRNQELVSECSHLRERLCQYENEKAERE - UNI9106 - VVVRQLQQELADTLKKQSMSEASLEVSSRYRSNLEEEARDLKKKLGQLRSQ LQEARDQ

HREAVHHAEKMEDHLQK - UNI6395 - KLELEKSKFEITIKKQSEEIDQLQENLSRVNL SEEDKEKLQKLTELKESLECTVDQEQKRSSALEKEL 

MRTIQKKCGKLEKNKKQLEQEVVNLRSHMEKNMVEHSQAQQYAREVEERARQDLVEKLKQVNLFLQ AQAASQESLEQLRENSNASVRSQMELRIKDLES

QLYRMKAQEDFDKIELEKYKQLYQEEFRARKSLSSKLNK KTSEKLEEASSKLLLEEQQNRSLLSTLSTRPVVECPCVGSFHNSLVFNRTLIPRENIVVP

TSGLQPSNKRVEIYLTK MHQELEKSINRELKEA ATAELESEFCRVSPLGSATKASQDQLSDASQEFIDILKKKYMIC
Transcript ENSMUST00000112830
Sequence
AGCAAGAAGGCGCGGGTTGCTAGTTTGCAGCTCGGCTTGGCGATTATTGTGCTTTAAAAACCTGCCGGGCCATGCAGCGTCTTTCCCGGTGGGATCCCGT

GCGTCTAGGCCGGCTTTTCAATAAGTGCCCTAGCTGCGTTGTGTTGTCAGCCAACGTTGCGCGGGGAAGAAGGTGCCTGTGAGGGGCGTACCCTCTGCCA

TGAAGAAGATTTTTGGCTTCAGGAGTAAGGGCCCATCGCCCTTAGGCCCCTCTGCCCGCCCGCGCAGCAACTGCGTGGGCTTTGGACGCGAGAGTGCTAG

TGGCTCCCACGTGCCCAGGTACCATATTCACGACAAGGATATGGGCAAGATCCACAAGGCTGCAAGCGTGGGAGATGTAGCCAAAGTGCAGCATATCCTT

ATCCTTGGAAAAAGTGGCGTGAACGATAGAGACAAGAAGGACAG GACTGCTCTACATCTTGCCTGTGCTTACGGCCACCCAGAAGTGGTGACTCTCTTA

GTAGAGAGAAAATGTGAGATAGATGCCCGTGACAGCGAGAGCAGCACGGCCCTCATTAAG GCCGTGCAGTGCCAGGAGGAAGAATGTGCAGCCATACTG

CTGGACCACGGGGCCGATCCAAATGTGATGGACAGCAGCGGCAACACCGCCCTCCACTACGCGGTCTACAGTGAGAACACGTCCATGGCAGCCAAACTGC

TCGCACACAATGCAAACATAGAAGCCAAAAACAAG GATGACCTAACACCTATGTTACTTGCTGTAAAGGAAAATAAACAACATATTGTGGAATTTTTAG

TAAAGAAGAAAGCAAGTATTCACGCAGTTGATCAGCTTGGAAG CAACAGGCAAATGTTTGAATATGATGGGAAGAGACTACAAAGATCTGAAAACAGCA

ATCCAG TGGATAATGGTTCTGAAGATGGCTCTTTAACCAG GTCTTATAACACACCTGGCCCTGCTGATTCCTGGCCGACATCAGATGAGGAGGACTAT

AACTTTGACAACAAG AATGTCCCCAAAATTAATTTGACAGAGTTGTGGACAGCTGCTCAGCAGTCTAGGAAAAACC AAACAAAATGTGGCTTTGAGGA

GCTAGACAATGGAGCCCGGTTTGATGACAGTGATTCCCCTAGTGAAAGTGAAGATGCCATTGAGGTTGAGCCTGCGCCATCAGTCAGAGTCCAGACCCTC

TCCCCATCCCGTCAGTCACCTGACCCTGTG GAAGGAGCAACCGAGCTAGCAATTGAAGGAGAAGAAAACGGTACTGATGTTATTGAGAGCGCTTCACAG

GAGCAACCAAATCATGACAATTTAACCCGTGCTGATGGTTGGCACAAAAGTAATAAAAGTG - UNI9081 - AAATGATGTCTGCATTAGGATTAGGA

GAAGACGAAGATGAACACTCGCCTTGGGATTCTGAG - UNI9081 - AGTATCTCCGAGAGTGTGTCACTGAAAGACGTAGGTCACTTCTCTGGGACT

GCAGATCAAACGGGAAAAAGGAGAGCACATGGACAGATAGAAG ATGTGACTTATATACCTTCTTGCATGAGTGGATCAAGAAGCTTTAAAATGGCTAAA

CTAGAGGAGTCAAGAAATGTAGGCCTTCCGGTAGCCCACATGG AGGCCCCCAGGAAATATGCAATCATGGAG CCTACCATCGAAAGGAGGGCTCCTGT

TCTGAACAAAACGGAGACAGTGGGAATGACGGATGCACAGACTTTCAAGTCAG AGCCAGAATCAGTATCAAGAGAAGAACAGACAAGGCTCAGTGGCAG

CGAGGACAGCCAGCAGAAG GTTGAAGAAAAGAGAAAATACAAAAATAACGAAGCAGAACCCTCAGGAAATCTATACAGCGGTGCTGCTGACGGCGGTGC

TGATGTAAAGCCACAGAGTGGAGACACTGAGAACCAGCAGTCTCCCCGGGAGGGGAGTGAGGGACGTGGCAG TGGTCCTGCCTTGCTTATGAAGGAAGC

AAAGAAAATGGAAAATGAAAAATGGGTATCCAGAGAGCCCGCGAGGACGGCAATGAGTGAGCGCACCGGCTTACCAACTGGTGGCTGGCCACAAATGCAG

GATGGTTCCTGCTGGAGTGACACGGACCAAAGTGAAGCCAG GCCCACAAAGAAAACATCTAGTAAACATAACAAG GACAGCGGGCAGACAGCTGCAGT

GGACAACCTTGACGACTTTACTGAGTCGTCTGAAACAGCCTCTGAGGACCATGAGCTCCAGGGCCCTGATTCCGAGAGCATTTTGTGTGCGATCGAGCAT

CTCAGACTGGAGTGTAAAG ATACTGCTAGTCTATTGAAAATCCGGGATGCCGTTTATTCATATAAACGATTAATAGAACTTAAAAGAAGCCACTGTGAA

CTACTTACAGGAAAACTGAAAAGAATGGAAAACAAATATAAGGGATTGCAGAAGGAAATGTCAGAGACAGAAGAAGTGAAGTCACGGTTGGAACATGAAA

AGGTCGGATGGGAACAGGAGCTCTGCAGGCTGAG ATTTGCACTGAAACAAGAGGAAGAGAAGAGGAGGAGTGCAGACCAGCTTTCTGAGAAAACCTCGG

AGCAGCTTAGAAGGAAAGGCGAGCAGTGTCAGAGTGAGGTGGAAGCCAGGCAGCAGCTTGAAGCCTCTCTCAGAACCCTGGAGATGGAGCTGAAGACGGT

GAAAAGCCATCTCAACCAG GTCTTAGAGGAACGAAATGAGACTCAGAGGCAGCTCTCCCGAGAACAGAATGCCAGAATGTTACAAGATGGGATTCTTGC

AAGTCACCTCTGCAAGCAAAAGGAGATAGAAATGACGCAGAAGAAAATGACTTCTGAG GTTTCTGTTAGTCATGAAAAAGAAAAAGATCTATTGCATAA

AAACCAGAGGCTGCAGGATGAAGTTGCTGTGTTACGACTGGAAATGGACACAATAAAAAGCCATAACCAGGAGAAGGAAAAGAGGTATCTTGAGGATATT

AAGATTGCAAATGAGAAGAATGACAACCTTCAAAGGATGGTCAAGCTGAATGAAGAAACATTTACAAAAACCATATTCCAGTATACTGGACAGCTTAATA

GTCTTAAAGCTGAGAACACAATGCTGAGTTCTAAGCTGGACAACGAAAAACAAAATAAGGAGAGACTGGAAACAGACGTTGAGTCGTTCCGATCTAGGCT

GGCTTCTGCTCTGCATGATCACGCTGAAATTCAGACAGCAAAAAGAGACCTAGAAATTGCTTTCCAGAGAGCGAGAGATGAGTGGTTTCGTGTGAAAGAC

AAGATGAATTTCGATATGTCTAACCTCCGAGATAACAATGAGGTTCTCTCCCAACAGCTTTCTAAAACTGAAAGGAAGTTGAATAGCCTAGAAATTGAGT

TTCATCACACGAAAGATGAGCTTCGAGAGAAGACGCTGGCGTTAAAGCATGCGCAGAGAGACCTGAGCCAGACCCAGTGCCAGATGAAGGAGGTGGAGCA

CATGTTTCAGGACGAACAAGGCAAAGTGAGCAAGTTCATGGGGAAGCAGGAGTCCATAGAGGAGAGGCTGGCCCAGCTGCAGAGTGAGAACACGCTGCTC

CGGCAGCAGCTGGACGACGCTGCCAACAAGGCCGAGAGCAAAGACAAGACCATAGTCAACATCCAAGACCAGTTCCAGGATGTGCTAACCAGGTTCCAAG

CTGAGAGTCAGCGGCACAGCCTGAGGCTAGAAGACAGAAACCAGGAGTTAGTCAGTGAGTGCAGCCATCTAAGAGAAAGACTGTGTCAGTACGAGAACGA

GAAAGCCGAAAGAGAG - UNI9106 - GTAGTTGTGAGGCAACTCCAGCAAGAATTGGCTGATACCCTAAAAAAGCAGTCGATGTCAGAGGCTTCGCT

GGAAGTCTCCTCCCGCTACCGCAGCAATTTAGAAGAAGAGGCGCGAGACTTAAAGAAGAAATTAGGTCAGCTCAGAAGTCAG TTGCAGGAGGCGCGGGA

TCAACACAGAGAGGCTGTACACCATGCTGAGAAGATGGAAGACCACCTACAAAA - UNI6395 - GCTTGAACTTGAAAAATCCAAGTTCGAAATTAC

AATTAAAAAGCAATCAGAGGAAATTGATCAACTTCAGGAAAACCTGTCAAGGGTGAATTTG TCTGAAGAGGATAAGGAAAAACTGCAGAAACTTACCGA

GTTGAAGGAGTCTCTGGAATGTACTGTGGATCAAGAACAGAAGAGAAGCAGTGCGTTAGAAAAAGAACTGGCAGA ATTTAAGGAAGTCTTAAAAATGAC

CAAAAAAGAATTAAATGAATATGAAAACAGAGAACTTAATCTTCGTCAAGATATAAAAAACAATCACCTTGAAATGGATATCCCAGTTAGTACACTAATA

AAAAAG ATTGATGATCTTACAGCAAAACTGGAAACTGCATCTTCAAAATGTCTACATCTGGGTAAAAAAAATCAGCTGCTTCAGCAGGAGTTACTATTG

ATGAGGACTATACAAAAGAAGTGTGGGAAACTAGAGAAGAATAAAAAGCAATTGGAGCAGGAGGTCGTGAACCTCAGAAGTCACATGGAGAAGAACATGG

TGGAGCACAGCCAAGCACAGCAGTACGCGCGGGAGGTCGAAGAGCGAGCGAGGCAGGACTTGGTGGAAAAGTTAAAACAGGTCAACCTCTTCCTGCAG G

CTCAAGCAGCATCCCAGGAGAGCTTGGAGCAGTTAAGAGAGAACAGTAACGCTTCGGTTAGAAGTCAGATGGAGCTCAGGATTAAAGACCTGGAGTCCCA

GCTCTACAGAATGAAAGCCCAGGAAGACTTCGATAAAATAGAACTGGAAAAGTATAAGCAGCTCTACCAGGAAGAGTTCAGAGCTAGAAAATCGCTGTCA

AGTAAACTAAACAA GACCAGTGAGAAGCTGGAGGAGGCCAGCAGCAAGCTGCTCCTGGAGGAGCAGCAGAACAGGTCCTTGCTGAGCACTCTGAGTACA

AGGCCTGTTGTGGAGTGTCCTTGTGTTGGAAGTTTCCATAATAGTTTGGTATTCAACAGAACTCTTATTCCAAGAGAAAACATAGTGGTTCCTACTTCAG

GCCTACAGCCATCAAATAAGAGAGTGGAGATCTACCTGACCAAG ATGCATCAAGAGTTGGAAAAAAGTATAAATAGAGAACTTAAAGAAG CTACTGCT

GAACTTGAATCTGAGTTCTGCAGAGTTTCTCCCCTGGGATCTGCTACTAAAGCAAGCCAAGATCAACTCTCAGACGCATCGCAAGAATTTATAGACATTC

TAAAGAAAAAATATATGATCTGCTGAATTTAAAAAGAGAAAAAGGAAGAAAAAGTAGAAGTGGGACTTTTTGGGAGAGAGGATCAGAGAAGTTAAAGGGG

CACGTGCTGTGTGTCTGAAATGTCTCCGTGGCCTGGGTGTGGTGGCACGTGTCTTTGACTCCAGCACTTGGGAAGCAGAGGCTGGTAGATCTCTGAATTC

AAGGGCAGTCAGAGCTACATGTCTCATACTGAAAAATAAAGTCATAATGGAACCTACTATTTTGTACAAATAATACACATTAATATACATGATCTAAAAT

ATAACATTTTGGGCTGGAAAGGTGCCTCAGGAGTTTGAGAGCACTGGCAGCTCTTCCCTAGGTCCTGAATTCAGTTCCCAGCATCCATATGGTGGCTCTA

ACCATCTATAATGTGATCTGGTGTCCTCTTTTGATGTGCAGGATTATGTGCAAATAGAACACTCATATTCATAAAATAAATCTTT
Translation
MKKIFGFRSKGPSPLGPSARPRSNCVGFGRESASGSHVPRYHIHDKDMGKIHKAASVGDVAKVQHILILGKSGVNDRDKKDR RTALHLACAYGHPEVVT

LLVERKCEIDARDSESSTALIK AVQCQEEECAAILLDHGADPNVMDSSGNTALHYAVYSENTSMAAKLLAHNANIEAKNK DDLTPMLLAVKENKQHIV

EFLVKKKASIHAVDQLGS SNRQMFEYDGKRLQRSENSNPV VDNGSEDGSLTR RSYNTPGPADSWPTSDEEDYNFDNK NVPKINLTELWTAAQQSRK

NQ QTKCGFEELDNGARFDDSDSPSESEDAIEVEPAPSVRVQTLSPSRQSPDPV EGATELAIEGEENGTDVIESASQEQPNHDNLTRADGWHKSNKSE 

- UNI9081 - EMMSALGLGEDEDEHSPWDSE - UNI9081 - SISESVSLKDVGHFSGTADQTGKRRAHGQIED DVTYIPSCMSGSRSFKMAKLE

ESRNVGLPVAHME EAPRKYAIME PTIERRAPVLNKTETVGMTDAQTFKSE EPESVSREEQTRLSGSEDSQQK VEEKRKYKNNEAEPSGNLYSGAAD

GGADVKPQSGDTENQQSPREGSEGRGS SGPALLMKEAKKMENEKWVSREPARTAMSERTGLPTGGWPQMQDGSCWSDTDQSEAR RPTKKTSSKHNK D

SGQTAAVDNLDDFTESSETASEDHELQGPDSESILCAIEHLRLECKD DTASLLKIRDAVYSYKRLIELKRSHCELLTGKLKRMENKYKGLQKEMSETEE

VKSRLEHEKVGWEQELCRLR RFALKQEEEKRRSADQLSEKTSEQLRRKGEQCQSEVEARQQLEASLRTLEMELKTVKSHLNQ VLEERNETQRQLSREQ

NARMLQDGILASHLCKQKEIEMTQKKMTSE VSVSHEKEKDLLHKNQRLQDEVAVLRLEMDTIKSHNQEKEKRYLEDIKIANEKNDNLQRMVKLNEETFT

KTIFQYTGQLNSLKAENTMLSSKLDNEKQNKERLETDVESFRSRLASALHDHAEIQTAKRDLEIAFQRARDEWFRVKDKMNFDMSNLRDNNEVLSQQLSK

TERKLNSLEIEFHHTKDELREKTLALKHAQRDLSQTQCQMKEVEHMFQDEQGKVSKFMGKQESIEERLAQLQSENTLLRQQLDDAANKAESKDKTIVNIQ

DQFQDVLTRFQAESQRHSLRLEDRNQELVSECSHLRERLCQYENEKAERE - UNI9106 - VVVRQLQQELADTLKKQSMSEASLEVSSRYRSNLEEE

ARDLKKKLGQLRSQ LQEARDQHREAVHHAEKMEDHLQK - UNI6395 - KLELEKSKFEITIKKQSEEIDQLQENLSRVNL SEEDKEKLQKLTELK

ESLECTVDQEQKRSSALEKELAE EFKEVLKMTKKELNEYENRELNLRQDIKNNHLEMDIPVSTLIKK IDDLTAKLETASSKCLHLGKKNQLLQQELLL

MRTIQKKCGKLEKNKKQLEQEVVNLRSHMEKNMVEHSQAQQYAREVEERARQDLVEKLKQVNLFLQ AQAASQESLEQLRENSNASVRSQMELRIKDLES

QLYRMKAQEDFDKIELEKYKQLYQEEFRARKSLSSKLNK KTSEKLEEASSKLLLEEQQNRSLLSTLSTRPVVECPCVGSFHNSLVFNRTLIPRENIVVP

TSGLQPSNKRVEIYLTK MHQELEKSINRELKEA ATAELESEFCRVSPLGSATKASQDQLSDASQEFIDILKKKYMIC

For any suggestions or comments, please send an email to unitrap@crg.es