Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000007850 (Hnrph1)
Chromosomal location
Chr 11: 50190492 - 50200030 (+)
Description
heterogeneous nuclear ribonucleoprotein H1 Gene [Source:MGI (curated);Acc:Hnrph1-005]
RefSeq_dna
NM_021510 
RefSeq_peptide
NP_067485.1 
UniGene
Mm.467852 
MGI
MGI:1891925 
Uniprot/SWISSPROT
O35737 
Uniprot/SPTREMBL
Q3TNG9 Q811L7 Q8C2Q7 
Human Ortholog
ENSG00000169045 (HNRNPH1)
Omim not available
UniTrap UNI37090
Vector Insertion
Chr 11: 50191792 - 50191930
Public Clones CMHD-GT_511H12-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15207
Vector Insertion
Chr 11: 50191930 - 50192969
Public Clones (sanger) PST9856-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6697
Vector Insertion
Chr 11: 50193467 - 50194960
Public Clones RRD086 (baygenomics) BGC468 (baygenomics) RRD003 (baygenomics) PST0058-NR (escells)
PST8045-NR (escells) PST13967-NR (escells) PST1083-2 (escells) PST58-2 (escells)
PST11640-NR (escells) PST13608-NR (escells) PST1083-3 (escells) PST11483-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15168
Vector Insertion
Chr 11: 50196374 - 50196429
Public Clones PST11816-NR (escells) PST11204-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15121
Vector Insertion
Chr 11: 50196817 - 50197181
Public Clones PST12521-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15309
Vector Insertion
Chr 11: 50197423 - 50198145
Public Clones PST11033-NR (escells) PST283-1 (escells)
Private Clones not available
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15574
Vector Insertion
Chr 11: 50198239 - 50198642
Public Clones PST2512-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109142
Sequence
AGTCTCAGCCTTCCCTCGCGAGGCGCCGCACACCGAGCGCCTCTCGTGCAAGGGCGAGGGGTTCGTAGAGTGCGAGTCCGTTAGGCAAAGTGGGGTACAG

GACTAGCTCGGGCACTGGCAGCCCATGTGGGTCGGGACTGACCCCCTAAAGCGGGCAG GAGCGCGGATGAAAAGCTGCGGATTAAGGGTAGAACTACCG

CCCCTGCAAACCTGAACGAACTCTGGATTACTACCCAGTCCCTGCGGGGAGCTGATTAGCGCCATTCCCCTCCCCCACTCCGGCGG CCCCGCAATCTGT

GTGGACGCCAGGACCACCGAAGGGACGATGATGCTGGGAGCAGAAGGCGGAGAGGGCTTCGTGGTGAAGGTCCGGGGCTTGCCCTGGTCCTGCTCCGCGG

ATGAAGTGCAGCGCTTTTTTTCTG - UNI15207 - ACTGCAAAATTCAAAATGGGGCTCAAGGTATTCGTTTCATCTACACCAGAGAAGGCAGACCA

AGTGGCGAGGCTTTTGTTGAACTTGAATCAGAAGATGAAGTCAAATTGGCCTTGAAAAAAGACAGAGAAACTATGGGACACAGATATGTTGAAG TATTC

AAGTCAAACAACGTTGAAATGGATTGGGTGTTGAAGCATACTGGTCCAAATAGTCCTGACACAGCCAATGATGGCTTTGTACGGCTTAGAGGACTCCCTT

TTGGATGTAGCAAGGAAGAAATTGTTCAGTTCTTCTCAG - UNI6697 - GGTTGGAAATCGTGCCAAATGGGATAACATTGCCGGTGGACTTCCAGG

GGAGGAGTACGGGGGAGGCCTTCGTGCAGTTTGCTTCACAGGAAATAGCTGAAAAGGCTCTAAAGAAACACAAGGAAAGAATAGGGCACAG GTATATTG

AAATATTTAAGAGCAGTCGAGCTGAAGTTAGAACTCATTATGACCCACCACGAAAACTTATGGCCATGCAGCGGCCAGGTCCCTATGACAGACCTGGGGC

TGGCAGAGGGTATAACAGCATTGGCAGAGGAGCTGGTTTTGAGAGGATGAGGCGTGGTGCTTATGGTGGAG GCTATGGAGGCTATGATGATTATAATGG

CTATAATGATGGCTATGGATTTGGTTCAGATAGATTTGGAAGAG - UNI15168 - ACCTCAATTATTGTTTTTCAGGAATGTCTGACCACAGATATG

GGGACGGTGGCTCTACTTTCCAGAGTACAACCGGACACTGTGTACACATGCGGGGATTACCATACAGAGCTACTGAGAATGACATTTATAAT TTTTTTT

CACCACTCAACCCTGTGAGAGTACATATTGAGATTGGACCTGATGGCAGAGTAACTGGTGAAGCAGATGTTGAGTTCGCAACCCATGAAGATGCTGTTGC

AGCTATGTCAAAAGATAAAGCAAATATGC - UNI15121 - AACACAGATATGTAGAGCTCTTCTTGAATTCTACAGCAGGAGCAAGCGGTGGTGCTT

ACG AACACAGATATGTAGAACTCTTCTTGAATTCTACAGCAGGAGCAAGCGGTGGTGCTTATGGTAGCCAAATGATGGGAGGCATGGGCTTGT - UNI

15309 - CAAACCAGTCCAGTTACGGTGGCCCAGCCAGCCAGCAGCTGAGTGGTGGTTATGGAGGTGGTTACGGTGGCCAGAGCAGCATGAGCGGATAT

G - UNI15574 - ACCAAGTTTTACAGGAAAACTCCAGTGATTTTCAATCAAACATTGCATAG GTAGCCAAGGAGCAGTGAACAGCAGCTACTACAG

TAATGGAAGCCGAGCATCTATGGGCGTGAATGGAATGGGAGGGATGTCTAGCATGTCTAGTATGAGTGGTGGATGGGGAATGTAATTGATTTTGATCACT

GACTCTTGGTCAAAAAGAAATTTTTTAAAAAACCCCTCAGTTTAACAGATTTTGCAATCCATCCAGCCTTGTGGTTTTATGCCTGCTCTTAAGTGAACAT

TGGCGTCGCTCAAAGAAGGCTCAATGTTGAGCATAGCAGTCACCTAGGATGATAGAGCAAAGCTGAGTGAACTGTAACTGTTAAACTTAATTCCTAGCTT

TTCTCTAGTTACTGTAGGATGTACGTAAGCAGTAAGTGTATTTAGGTTAAAGCAGTTGAATTATGTTAAATGTTGCTCTTATACATACATTGAACACTGT

TGATGCATGTTGAAAAACATGCTTTTTTGTAAAACTATAGGAGCTGCGTCTACAATTAAAGTGATACATTTGGCATGTTTGTTAATTCTAAATTTATTTG

ATAACCTGTAAGGCACGTGAGTTTAAAGCTCTTTTTTTTTATTTTTAAGTTAATGGAGAAGTTTTGAGAGACAATACCATTATTTTTTAGGATTTTTGGT

CTTAGTGTTTGTATGAAATTCTGAGGCCTTGATTTAAGTCTTTCATTGTATTGTGATTTCTTTTTAGGTGTATTGCGCTAAGTGAACCTTGTCAAATAAA

TCTTCCTTTTAAAAGCTA
Translation
  MMLGAEGGEGFVVKVRGLPWSCSADEVQRFFSD - UNI15207 - DCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYV

EV VFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSG - UNI6697 - GLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEK

ALKKHKERIGHR RYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGG GYGGYDDYNGYNDGYGFGSDRFGRD

 - UNI15168 - DLNYCFSGMSDHRYGDGGSTFQSTTGHCVHMRGLPYRATENDIYN FFSPLNPVRVHIEIGPDGRVTGEADVEFATHEDAVAAMSK

DKANMQ - UNI15121 - QHRYVELFLNSTAGASGGAYE EHRYVELFLNSTAGASGGAYGSQMMGGMGLS - UNI15309 - SNQSSYGGPASQQ

LSGGYGGGYGGQSSMSGYD - UNI15574 - DQVLQENSSDFQSNIA 
Transcript ENSMUST00000069304
Sequence
GCCGAGGCTTTTTGTGGAG CCCCGCAATCTGTGTGGACGCCAGGACCACCGAAGGGACGATGATGCTGGGAGCAGAAGGCGGAGAGGGCTTCGTGGTGA

AGGTCCGGGGCTTGCCCTGGTCCTGCTCCGCGGATGAAGTGCAGCGCTTTTTTTCTG - UNI15207 - ACTGCAAAATTCAAAATGGGGCTCAAGGT

ATTCGTTTCATCTACACCAGAGAAGGCAGACCAAGTGGCGAGGCTTTTGTTGAACTTGAATCAGAAGATGAAGTCAAATTGGCCTTGAAAAAAGACAGAG

AAACTATGGGACACAGATATGTTGAAG TATTCAAGTCAAACAACGTTGAAATGGATTGGGTGTTGAAGCATACTGGTCCAAATAGTCCTGACACAGCCA

ATGATGGCTTTGTACGGCTTAGAGGACTCCCTTTTGGATGTAGCAAGGAAGAAATTGTTCAGTTCTTCTCAG - UNI6697 - GGTTGGAAATCGTGC

CAAATGGGATAACATTGCCGGTGGACTTCCAGGGGAGGAGTACGGGGGAGGCCTTCGTGCAGTTTGCTTCACAGGAAATAGCTGAAAAGGCTCTAAAGAA

ACACAAGGAAAGAATAGGGCACAG GTATATTGAAATATTTAAGAGCAGTCGAGCTGAAGTTAGAACTCATTATGACCCACCACGAAAACTTATGGCCAT

GCAGCGGCCAGGTCCCTATGACAGACCTGGGGCTGGCAGAGGGTATAACAGCATTGGCAGAGGAGCTGGTTTTGAGAGGATGAGGCGTGGTGCTTATGGT

GGAG GCTATGGAGGCTATGATGATTATAATGGCTATAATGATGGCTATGGATTTGGTTCAGATAGATTTGGAAGAG - UNI15168 - ACCTCAATT

ATTGTTTTTCAGGAATGTCTGACCACAGATATGGGGACGGTGGCTCTACTTTCCAGAGTACAACCGGACACTGTGTACACATGCGGGGATTACCATACAG

AGCTACTGAGAATGACATTTATAAT TTTTTTTCACCACTCAACCCTGTGAGAGTACATATTGAGATTGGACCTGATGGCAGAGTAACTGGTGAAGCAGA

TGTTGAGTTCGCAACCCATGAAGATGCTGTTGCAGCTATGTCAAAAGATAAAGCAAATATGC - UNI15121 - AACACAGATATGTAGAGCTCTTCT

TGAATTCTACAGCAGGAGCAAGCGGTGGTGCTTACG AACACAGATATGTAGAACTCTTCTTGAATTCTACAGCAGGAGCAAGCGGTGGTGCTTATGGTA

GCCAAATGATGGGAGGCATGGGCTTGT - UNI15309 - CAAACCAGTCCAGTTACGGTGGCCCAGCCAGCCAGCAGCTGAGTGGTGGTTATGGAGGT

GGTTACGGTGGCCAGAGCAGCATGAGCGGATATG - UNI15574 - ACCAAGTTTTACAGGAAAACTCCAGTGATTTTCAATCAAACATTGCATAG G

TAGCCAAGGAGCAGTGAACAGCAGCTACTACAGTAATGGAAGCCGAGCATCTATGGGCGTGAATGGAATGGGAGGGATGTCTAGCATGTCTAGTATGAGT

GGTGGATGGGGAATGTAATTGATTTTGATCACTGACTCTTGGTCAAAAAGAAATTTTTTAAAAAACCCCTCAGTTTAACAGATTTTGCAATCCATCCAGC

CTTGTGGTTTTATGCCTGCTCTTAAGTGAACATTGGCGTCGCTCAAAGAAGGCTCAATGTTGAGCATAGCAGTCACCTAGGATGATAGAGCAAAGCTGAG

TGAACTGTAACTGTTAAACTTAATTCCTAGCTTTTCTCTAGTTACTGTAGGATGTACGTAAGCAGTAAGTGTATTTAGGTTAAAGCAGTTGAATTATGTT

AAATGTTGCTCTTATACATACATTGAACACTGTTGATGCATGTTGAAAAACATGCTTTTTTGTAAAACTATAGGAGCTGCGTCTACAATTAAAGTGATAC

ATTTGGCATGTTTGTTAATTCTAAATTTATTTGATAACCTGTAAGGCACGTGAGTTTAAAGCTCTTTTTTTTTATTTTTAAGTTAATGGAGAAGTTTTGA

GAGACAATACCATTATTTTTTAGGATTTTTGGTCTTAGTGTTTGTATGAAATTCTGAGGCCTTGATTTAAGTCTTTCATTGTATTGTGATTTCTTTTTAG

GTGTATTGCGCTAAGTGAACCTTGTCAAATAAATCTTCCTTTTAAAAGCT
Translation
 MMLGAEGGEGFVVKVRGLPWSCSADEVQRFFSD - UNI15207 - DCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVE

V VFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSG - UNI6697 - GLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKA

LKKHKERIGHR RYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGG GYGGYDDYNGYNDGYGFGSDRFGRD 

- UNI15168 - DLNYCFSGMSDHRYGDGGSTFQSTTGHCVHMRGLPYRATENDIYN FFSPLNPVRVHIEIGPDGRVTGEADVEFATHEDAVAAMSKD

KANMQ - UNI15121 - QHRYVELFLNSTAGASGGAYE EHRYVELFLNSTAGASGGAYGSQMMGGMGLS - UNI15309 - SNQSSYGGPASQQL

SGGYGGGYGGQSSMSGYD - UNI15574 - DQVLQENSSDFQSNIA 
Transcript ENSMUST00000077817
Sequence
GCCGAGGCTTTTTGTGGAG CCCCGCAATCTGTGTGGACGCCAGGACCACCGAAGGGACGATGATGCTGGGAGCAGAAGGCGGAGAGGGCTTCGTGGTGA

AGGTCCGGGGCTTGCCCTGGTCCTGCTCCGCGGATGAAGTGCAGCGCTTTTTTTCTG - UNI15207 - ACTGCAAAATTCAAAATGGGGCTCAAGGT

ATTCGTTTCATCTACACCAGAGAAGGCAGACCAAGTGGCGAGGCTTTTGTTGAACTTGAATCAGAAGATGAAGTCAAATTGGCCTTGAAAAAAGACAGAG

AAACTATGGGACACAGATATGTTGAAG TATTCAAGTCAAACAACGTTGAAATGGATTGGGTGTTGAAGCATACTGGTCCAAATAGTCCTGACACAGCCA

ATGATGGCTTTGTACGGCTTAGAGGACTCCCTTTTGGATGTAGCAAGGAAGAAATTGTTCAGTTCTTCTCAG - UNI6697 - GGTTGGAAATCGTGC

CAAATGGGATAACATTGCCGGTGGACTTCCAGGGGAGGAGTACGGGGGAGGCCTTCGTGCAGTTTGCTTCACAGGAAATAGCTGAAAAGGCTCTAAAGAA

ACACAAGGAAAGAATAGGGCACAG GTATATTGAAATATTTAAGAGCAGTCGAGCTGAAGTTAGAACTCATTATGACCCACCACGAAAACTTATGGCCAT

GCAGCGGCCAGGTCCCTATGACAGACCTGGGGCTGGCAGAGGGTATAACAGCATTGGCAGAGGAGCTGGTTTTGAGAGGATGAGGCGTGGTGCTTATGGT

GGAG GCTATGGAGGCTATGATGATTATAATGGCTATAATGATGGCTATGGATTTGGTTCAGATAGATTTGGAAGAG - UNI15168 - ACCTCAATT

ATTGTTTTTCAGGAATGTCTGACCACAGATATGGGGACGGTGGCTCTACTTTCCAGAGTACAACCGGACACTGTGTACACATGCGGGGATTACCATACAG

AGCTACTGAGAATGACATTTATAAT TTTTTTTCACCACTCAACCCTGTGAGAGTACATATTGAGATTGGACCTGATGGCAGAGTAACTGGTGAAGCAGA

TGTTGAGTTCGCAACCCATGAAGATGCTGTTGCAGCTATGTCAAAAGATAAAGCAAATATGC - UNI15121 - AACACAGATATGTAGAGCTCTTCT

TGAATTCTACAGCAGGAGCAAGCGGTGGTGCTTACG AACACAGATATGTAGAACTCTTCTTGAATTCTACAGCAGGAGCAAGCGGTGGTGCTTATGGTA

GCCAAATGATGGGAGGCATGGGCTTGT - UNI15309 - CAAACCAGTCCAGTTACGGTGGCCCAGCCAGCCAGCAGCTGAGTGGTGGTTATGGAGGT

GGTTACGGTGGCCAGAGCAGCATGAGCGGATATG - UNI15574 - GTAGCCAAGGAGCAGTGAACAGCAGCTACTACAGTAATGGAAGCCGAGCATC

TATGGGCGTGAATGGAATGGGAGGGATGTCTAGCATGTCTAGTATGAGTGGTGGATGGGGAATGTAATTGATTTTGATCACTGACTCTTGGTCAAAAAGA

AATTTTTTAAAAAACCCCTCAGTTTAACAGATTTTGCAATCCATCCAGCCTTGTGGTTTTATGCCTGCTCTTAAGTGAACATTGGCGTCGCTCAAAGAAG

GCTCAATGTTGAGCATAGCAGTCACCTAGGATGATAGAGCAAAGCTGAGTGAACTGTAACTGTTAAACTTAATTCCTAGCTTTTCTCTAGTTACTGTAGG

ATGTACGTAAGCAGTAAGTGTATTTAGGTTAAAGCAGTTGAATTATGTTAAATGTTGCTCTTATACATACATTGAACACTGTTGATGCATGTTGAAAAAC

ATGCTTTTTTGTAAAACTATAGGAGCTGCGTCTACAATTAAAGTGATACATTTGGCATGTTTGTTAATTCTAAATTTATTTGATAACCTGTAAGGCACGT

GAGTTTAAAGCTCTTTTTTTTTATTTTTAAGTTAATGGAGAAGTTTTGAGAGACAATACCATTATTTTTTAGGATTTTTGGTCTTAGTGTTTGTATGAAA

TTCTGAGGCCTTGATTTAAGTCTTTCATTGTATTGTGATTTCTTTTTAGGTGTATTGCGCTAAGTGAACCTTGTCAAATAAATCTTCCTTTTAAAAGCT
Translation
 MMLGAEGGEGFVVKVRGLPWSCSADEVQRFFSD - UNI15207 - DCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVE

V VFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSG - UNI6697 - GLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKA

LKKHKERIGHR RYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGG GYGGYDDYNGYNDGYGFGSDRFGRD 

- UNI15168 - DLNYCFSGMSDHRYGDGGSTFQSTTGHCVHMRGLPYRATENDIYN FFSPLNPVRVHIEIGPDGRVTGEADVEFATHEDAVAAMSKD

KANMQ - UNI15121 - QHRYVELFLNSTAGASGGAYE EHRYVELFLNSTAGASGGAYGSQMMGGMGLS - UNI15309 - SNQSSYGGPASQQL

SGGYGGGYGGQSSMSGYG - UNI15574 - GSQGAVNSSYYSNGSRASMGVNGMGGMSSMSSMSGGWGM

For any suggestions or comments, please send an email to unitrap@crg.es