Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000008384 (Sertad1)
Chromosomal location
Chr 7: 28271972 - 28275330 (+)
Description
SERTA domain containing 1 Gene [Source:MGI (curated);Acc:Sertad1-001]
RefSeq_dna
NM_018820 
RefSeq_peptide
NP_061290.1 
UniGene
Mm.153684 
MGI
MGI:1913438 
Uniprot/SWISSPROT
Q9JL10 
Human Ortholog
ENSG00000197019 (SERTAD1)
Omim not available
UniTrap UNI12064
Vector Insertion
Chr 7: 28272098 - 28274271
Public Clones (sanger) D183G12 (ggtc) W242B04 (ggtc) D110F07 (ggtc) IST14140A3 (tigm)
Private Clones OST448534 (lexicon) OST374322 (lexicon) OST284852 (lexicon) OST279594 (lexicon)
OST274151 (lexicon) OST230364 (lexicon) OST198209 (lexicon) OST197789 (lexicon)
OST177176 (lexicon) OST169609 (lexicon) OST138383 (lexicon) OST116389 (lexicon)
OST6922 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000008528
Sequence
AGAACTGCGCCTACCGTCCCAGGTGTCGGTTGCTGGAGCAGAACAAGCTAGCGATGCTACGGCAGCCGCTTCCTGATTGGCTGCGTGTGGCTCCCTCTTC

GTTCTGATTGGCCGCGAGTGATCTGT - UNI12064 - AGGATGCTGAGCAAAGGTCTGAAGCGCAAGCGGGAGGAGGAGGAGACGATGGAAGCCCTC

TCCGTGGACTCGTGCTGGTTGGATCCGAGCCACCCGGCAGTGGCGCAGACCCCGCCGACGGTGGCTTCTAGCTCCCTCTTTGACCTCTCAGTGGTCAAGC

TCCACCACAGCCTGCGGCAGAGCGAGCCGGACCTCCGGCACCTGGTGCTTGTGGTGAACACACTGAGGCGCATCCAGGCGTCCATGGAACCCGCACCTGT

CCTGCCGCCTGAGCCCATCCAGCCCCCAGCCCCTTCTGTGGCAGACAGCCTTCTGGCTAGCTCAGATGCTGGCCTCTCAGCCTCCATGGCCAGCCTCCTG

GAAGATCTCAACCACATTGAGGACCTGAACCAGGCCCCCCAACCCCAAGCAGATGAGGGGCCTCCAGGCCGCTCCATCGGGGGGATCTCACCCAACCTGG

GTGCCTTGGACTTGCTAGGCCCAGCCACTGGCTGTCTGCTGGACGATGGACTGGAGGGCCTGTTTGAGGACATCGATACCTCCATGTACGACAGTGAACT

TTGGTTACCAGCCTCTGAGGGTCTCAAGCCCGGCCCTGAGAATGGCCCAGCCAAGGAGGAGCCTCCAGAGTTGGATGAGGCGGAGTTGGACTACCTCATG

GATGTACTAGTAGGCACACAGGCACTGGAAAGGCCACCAGGGCCTGGGCGCTGACCCTTAGGACCCAGGGAGAATTGACTTGGATCTGAGTTGAGCCTGG

TGGTGACACCAACCCACTTTGACACGACACAGGTGGCGTCCCCTCACAGAGGAGAGCCAGGGTCACTTTGGAGAGACTGTACTGAGTCCTGGGAACTTCA

CATCCATCCACCTGTCTTGACCAGTGAAGGAGTTGGAAATGAGCCCCGAGTGGTGAAATGACAGGGCCCAGTGACAGTAATGGTGTTTGGGCCAGGCTGG

GGTTGAACTGGGATAATAGTTTGGGCTATCCCATCCCATTATCCCCAGTGTGGGAAGAGACCTCATAATTTTTTGAAATTAAAACCAGCTTTGGGAAAT
Translation
 - UNI12064 - MLSKGLKRKREEEETMEALSVDSCWLDPSHPAVAQTPPTVASSSLFDLSVVKLHHSLRQSEPDLRHLVLVVNTLRRIQASMEPAPV

LPPEPIQPPAPSVADSLLASSDAGLSASMASLLEDLNHIEDLNQAPQPQADEGPPGRSIGGISPNLGALDLLGPATGCLLDDGLEGLFEDIDTSMYDSEL

WLPASEGLKPGPENGPAKEEPPELDEAELDYLMDVLVGTQALERPPGPGR

For any suggestions or comments, please send an email to unitrap@crg.es