Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000008604 (Ubqln4)
Chromosomal location
Chr 3: 88357638 - 88373647 (+)
Description
ubiquilin 4 Gene [Source:MGI Symbol;Acc:MGI:2150152]
RefSeq_dna
NM_033526 
RefSeq_peptide
NP_277068.1 
UniGene
Mm.303059 
MGI
MGI:2150152 
Uniprot/SWISSPROT
Q99NB8 
Human Ortholog
ENSG00000160803 (UBQLN4)
Omim not available
UniTrap UNI22257
Vector Insertion
Chr 3: 88357835 - 88359259
Public Clones (sanger) PST25453-NR (escells) PST20241-NR (escells) IST15105F10 (tigm)
IST12631E10 (tigm) IST11824F10 (tigm) IST11825F10 (tigm) IST10971E3 (tigm)
IST12078H8 (tigm)
Private Clones OST302186 (lexicon) OST146908 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6046
Vector Insertion
Chr 3: 88359412 - 88359711
Public Clones YHD059 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6027
Vector Insertion
Chr 3: 88359915 - 88360578
Public Clones CSH600 (baygenomics) PST7073-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30789
Vector Insertion
Chr 3: 88360842 - 88363539
Public Clones IST14664G2 (tigm) IST10320D11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9685
Vector Insertion
Chr 3: 88363699 - 88367029
Public Clones XG130 (baygenomics) XG905 (baygenomics) IST14850F3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38533
Vector Insertion
Chr 3: 88367256 - 88368291
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9005
Vector Insertion
Chr 3: 88369013 - 88369134
Public Clones XK101 (baygenomics) XK538 (baygenomics) XF207 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5723
Vector Insertion
Chr 3: 88369251 - 88369612
Public Clones CSI124 (baygenomics) D114E03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31828
Vector Insertion
Chr 3: 88369800 - 88372002
Public Clones 5SE171F11 (ggtc) (ggtc) 3SE171F11 (ggtc) IST11721E11 (tigm) IST10245D11 (tigm)
IST11972F11 (tigm) IST11066E6 (tigm) IST11167G12 (tigm) IST10280G2 (tigm)
IST11971F11 (tigm) IST10851F2 (tigm) IST15051G10 (tigm) IST11284E1 (tigm)
IST11290D3 (tigm) IST11636C8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000008748
Sequence
GTTGGAGGCCCCGGAGTCGGGCCGGGCCGGGCGGGCCGGGAGGAGGAGGAGGAGGAGCCGGACGGGCTGGCGGGCGGCCGGGCGGCGGCATGGCGGAGCC

GAGTGGGGCTGAGACGAGGCCCCAGATTCGGGTCACCGTCAAGACCCCCAAGGACAAGGAGGAGATCGTGATCTGCGATCAAGCCTCGGTCAAGGAG - 

UNI22257 - TTCAAGGAGGAGATCTCCCGGAGGTTTAAGGCTCAGCAGGATCAGCTGGTCCTGATCTTCGCAGGCAAGATCCTCAAGGATGGGGACAC

CCTGAGCCAGCACGGCATCAAGGATGGGCTCACAGTCCACCTAGTCATCAAAACCCCTCAGAA - UNI6046 - GGCTCAAGATCCAGTGACTGCTGC

TGCTTCTCCTCCATCCACTCCTGACTCTGCCTCTGCACCCTCCACCACGCCTGCCTCACCTGCCGCCGCCCCTGTCCAGCCCTGCAGCTCTGGCAATACA

ACTTCAGATGCTGGCAGTGGAGGGGGGCCCTCTCCAGTGGCTGCAGAGGGGCCCTCAAGTGCTACTGCATCGATCCTCT - UNI6027 - CTGGCTTC

GGAGGCATCCTGGGACTGGGCAGCCTGGGCCTGGGCTCCGCCAACTTTATGGAGCTGCAGCAACAGATGCAGAGACAGCTCATGTCCAATCCTGAGATGC

TGTCGCAGATCATGGAGAACCCCTTGGTCCAGGATATGATGTCAAACCCTGATCTGATGCGCCACATGATCATGGCTAATCCCCAGATGCAGCAGCTGAT

GGAGAGGAACCCCGAGATCAGCCACATGCTCAACAACCCAGAGCTCATGAGGCAG - UNI30789 - ACAATGGAGCTTGCTCGTAACCCAGCCATGA

TGCAAGAAATGATGCGGAACCAGGACCGGGCCCTCAGCAACCTGGAAAGTGTCCCGGGAGGGTATAATGCCCTCCGCCGCATGTACACGGACATCCAGGA

GCCCATGTTCACTGCTGCTCGGGAACAG - UNI9685 - TTTGGCAACAATCCCTTCTCTTCCCTGGCCGGGAACTCCGACAACTCATCCTCCCAACC

TCTTCGGACTGAGAATCGAGAGCCCCTCCCTAACCCCTGGAGCCCCTCGCCCCCCACCTCCCAGGCCCCCGGGTCCGGTGGGGAGGGCACCGGAGGATCG

GGGACCAGCCAGGTGCACCCGACAGTCTCGAACCCCTTTGGGATCAATGCGGCTAGCCTGGGGTCAG GGATGTTCAACAGCCCAGAAATGCAGGCGCTC

CTCCAGCAGATTTCTGAAAACCCCCAGCTGATGCAGAATGTCATCTCAGCCCCTTACATGCGCACCATGATGCAGACGCTTGCCCAGAACCCTGACTTTG

CTGCTCAG ATGATGGTGAATGTGCCGCTGTTCGCAGGGAATCCACAGCTTCAGGAGCAGCTCCGCCTGCAGCTCCCCGTGTTTCTGCAGCAG - UNI9

005 - ATGCAAAACCCAGAGTCTCTCTCCATCCTCACCAATCCCCGGGCCATGCAGGCCCTGCTGCAGATCCAGCAGGGACTACAGACCCTCCAGACTG

AAGCCCCTGGGCTGGTACCCAG - UNI5723 - CCTTGGCTCCTTTGGGACACCCCGGACCTCGGTACCTCTGGCAGGCAGCAACTCTGGATCTTCGG

CAGAGGCCCCCACTTCTTCCCCGGGCGTGCCAGCCACATCTCCTCCCAGTGCGGGTTCCAATGCCCAGCAACAACTCATGCAGCAGATGATCCAACTTTT

GTCCGGAAGTGGGAACTCACAG - UNI31828 - GTGCCGATGCCAGAAGTGAGATTTCAACAGCAGCTGGAACAACTCAACTCCATGGGCTTTATTA

ACCGTGAGGCCAACCTACAGGCCCTGATCGCCACAGGAGGGGACATCAATGCCGCTATTGAGAGACTCCTGGGCTCCCAGCTCTCCTGATCCCTTGGCTG

GTGCCTCCTGCCTTCCCCACCTCTCAGCGCCAGCCTCTGGCTCCTCTGTGAAGCCCTATCTTCCATGGCCTGTCTTCTTTGACCCCTACGAACAGAGCAG

CAAGAACCGCAGGGTGACTTCCAACTTCCAAGGCCTCTGCCCAACCCAAAGCTCTCCAAGGATTTTGATTCGTTTACTGTCTCATGAAATCTCTCCCGGT

CCTCTTGGAGCAGAGCTATCTAGTGTGCACAGTGTGCCAGTTTGGCCACATCTCCTTGCCCACAAGTACCTTGGCAACATACATTCTTCTCCAGGGGACT

GAGAGGAGGACCCCGCCTGGCGTACCGGAAGTCTTCCGTTGGTACCACTAGAGTTTAGCTAGCCTTACATTACTCCTACCCTCCTCTCCCTCCCTCACCT

CAGCCCAACCAGTTTGAATCTCACTCTTTGGCCAGGTCCTGGTGAAACTGTTTTTTTTTTCTCTACCCCTATACTGTTTCATATAGCCTGTCCTTCTGTC

CAAAGGCAGCAGTGAGTCAGCAGTCTGGGTAGGGTTATCAAGATCAAACCAGACCAGTGGACACTGGTGCTCTAGAGCCACAGCTGAGAGCTCTCGGAAG

CAGGGACCCGGGGAGACAGCCTGGGCAGGAGGCTTGGAAGTTGGAGTTGACAGAGTCTAGAAAGACCAATAGATTTCATGGTGGAGAAGCCAGGCTCAGG

CCTGACAGAAGAAAGTCTGATGGACTTGGAACTGAAGATAGAAGTTCAGCAAAGCTGAACAGTGTGACCCATGAGAAATCAAATTGGCTCCATTGTTTCC

AGACATATTTGCGCTCACGTTCCAATGAACCCAGTCTTCAGGCTCCAGTATTTTGAGCCCCACTCTCCAGAAGATCTGGTGGGGTTTCTCAGCATTGTAG

AAAATCTATATGTGTGCGTACATGCAAGTTGGGGAGGTGTGTGTTCTTTGTTGATTTCTGGTTCACAACTTTGTCAACAGAGATAAGTGGGTACAAGGGC

CAATCTTGTGGAAGACTATAGCATTGAGGGAGCCGGGTCCCTGGGCCTCTGGGTATTGGGTAACCAGAAAGCAGATTGAGTAATTCTCTGAGCAATAATG

GCTCTGACTGGTACCCTGGCCACCATTGCTTCCTTGGTGAAAGAATAGTGAGGTTTCTCTTCCAGAGCTCCTGCCTTTCAGTTATTTGCTGGTTCCCTCT

AGGCCAGAAACTTGTATTTGAGGAGAGGTGGGATGGCAGATGCCTTTGGTATGGAACTGGGCTTTGCTTAACGAGTACCAGAGGAAGCTCTCGCCACATT

TTCTCTGCTGTGTGGTCCAGGTACTTGGAGGACCCCTGGCTGAGAGACAGGTAAGGAAAGGCATCCTGCCGTAGGTGGGGGACAGTCCCAGACAGTTCAG

ACATGCCTTCCCTTCCCCCCTTATACCCAACACCCACTCTGGCCTTTGTAAATAAATAATGTGATTTTTGTTGTGAGATTA
Translation
MAEPSGAETRPQIRVTVKTPKDKEEIVICDQASVKE - UNI22257 - FKEEISRRFKAQQDQLVLIFAGKILKDGDTLSQHGIKDGLTVHLVIKTPQ

K - UNI6046 - KAQDPVTAAASPPSTPDSASAPSTTPASPAAAPVQPCSSGNTTSDAGSGGGPSPVAAEGPSSATASILS - UNI6027 - SGFG

GILGLGSLGLGSANFMELQQQMQRQLMSNPEMLSQIMENPLVQDMMSNPDLMRHMIMANPQMQQLMERNPEISHMLNNPELMRQ - UNI30789 - TM

ELARNPAMMQEMMRNQDRALSNLESVPGGYNALRRMYTDIQEPMFTAAREQ - UNI9685 - FGNNPFSSLAGNSDNSSSQPLRTENREPLPNPWSPS

PPTSQAPGSGGEGTGGSGTSQVHPTVSNPFGINAASLGSG GMFNSPEMQALLQQISENPQLMQNVISAPYMRTMMQTLAQNPDFAAQ MMVNVPLFAGN

PQLQEQLRLQLPVFLQQ - UNI9005 - MQNPESLSILTNPRAMQALLQIQQGLQTLQTEAPGLVPS - UNI5723 - SLGSFGTPRTSVPLAGSN

SGSSAEAPTSSPGVPATSPPSAGSNAQQQLMQQMIQLLSGSGNSQ - UNI31828 - VPMPEVRFQQQLEQLNSMGFINREANLQALIATGGDINAAI

ERLLGSQLS

For any suggestions or comments, please send an email to unitrap@crg.es