Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000008730 (Hipk1)
Chromosomal location
Chr 3: 103543738 - 103595486 (-)
Description
homeodomain interacting protein kinase 1 Gene [Source:MGI (curated);Acc:Hipk1-001]
RefSeq_dna
NM_010432 
RefSeq_peptide
NP_034562.2 
UniGene
Mm.20827 Mm.406617 Mm.413631 Mm.416552 Mm.475514 
MGI
MGI:1314873 
Uniprot/SWISSPROT
O88904 
Uniprot/SPTREMBL
A0S0L1 A0S0L4 A0S0L5 A0S0D6 A0S0D7 A0S0D8 A0S0D9 A0S0E0 A0S0E1 A0S0E2 A0S0L0 A9R9X1 A0S0L2 A0S0L3 A6H5Z7 A9R9X0 A9R9X2 
Human Ortholog
ENSG00000163349 (HIPK1)
Omim not available
UniTrap UNI30340
Vector Insertion
Chr 3: 103582223 - 103594917
Public Clones 5SE113G01 (ggtc) 3SE050C01 (ggtc) 5SE121F01 (ggtc) CMHD-GT_413B8-3 (cmhd)
IST11560A11 (tigm) IST10262H10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25029
Vector Insertion
Chr 3: 103573445 - 103581144
Public Clones IST10266E1 (tigm) IST14921C12 (tigm) IST14841H4 (tigm) IST14905H7 (tigm)
IST10568C2 (tigm)
Private Clones OST197662 (lexicon)
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18385
Vector Insertion
Chr 3: 103568505 - 103573320
Public Clones not available
Private Clones OST424292 (lexicon)
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106838
Sequence
AGGACGGGCGCGGGGACGGCTCCGGGGGGCGGGGGCCGGGGCCGGGGCCGGCTCGTGCGGGGGGTATGATGACCCGGCTGCGGGGCCCCGGATCGCCTCT

CCTCCGCCGCCTCCTCGCGGCGGCCCCGACTCGAGGCTGAGAACTACACACACCGGCG - UNI30340 - GTATGGCCTCACAGCTGCAGGTGTTTTC

GCCCCCATCAGTGTCGTCGAGTGCCTTCTGCAGTGCAAAGAAACTGAAAATAGAGCCCTCTGGCTGGGATGTTTCAGGACAGAGCAGCAACGACAAATAC

TATACCCACAGCAAAACCCTCCCAGCTACACAAGGGCAAGCCAGCTCCTCTCACCAGGTAGCAAATTTCAATCTTCCTGCTTACGACCAGGGCCTCCTTC

TCCCAGCTCCTGCCGTGGAGCATATTGTGGTAACAGCTGCTGATAGCTCAGGCAGCGCCGCTACAGCAACCTTCCAAAGCAGCCAGACCCTGACTCACAG

GAGCAACGTTTCTTTGCTTGAGCCATATCAAAAATGTGGATTGAAGAGAAAGAGTGAGGAAGTGGAGAGCAACGGTAGCGTGCAGATCATAGAAGAACAC

CCCCCTCTCATGCTGCAGAACAGAACCGTGGTGGGTGCTGCTGCCACGACCACCACTGTGACCACCAAGAGTAGCAGTTCCAGCGGAGAAGGGGATTACC

AGCTGGTCCAGCATGAGATCCTTTGCTCTATGACCAACAGCTATGAAGTCCTGGAGTTCCTAGGCCGGGGGACATTTGGACAGGTGGCAAAGTGCTGGAA

GCGGAGCACCAAGGAAATTGTGGCCATTAAGATCTTGAAGAACCACCCCTCCTATGCCAGACAAGGACAGATTGAAGTGAGCATCCTTTCCCGCCTAAGC

AGTGAAAATGCTGATGAGTATAACTTTGTCCGTTCTTATGAGTGTTTTCAGCACAAGAATCATACCTGCCTTGTGTTTGAGATGTTGGAGCAGAACTTGT

ACGATTTTCTAAAGCAGAACAAGTTTAGCCCACTGCCACTCAAGTACATAAGACCAATCTTGCAGCAGGTGGCCACAGCCCTGATGAAGCTGAAGAGTCT

TGGTCTGATTCATGCTGACCTTAAACCTGAAAACATAATGCTAGTCGATCCAGTTCGCCAACCCTACCGAGTGAAGGTCATTGACTTTGGTTCTGCTAGT

CATGTTTCCAAAGCCGTGTGTTCAACCTACCTGCAATCACGCTACTACAG - UNI25029 - AGCTCCTGAAATTATCCTTGGATTACCATTCTGTGA

AGCTATTGACATGTGGTCACTGGGCTGTGTAATAGCTGAGCTGTTCCTGGGATGGCCTCTTTATCCTGGTGCTTCAGAATACGATCAG - UNI18385 

- ATTCGCTATATTTCACAAACACAAGGCCTGCCAGCTGAGTATCTTCTCAGTGCCGGAACAAAAACAACCAGGTTTTTTAACAGAGATCCTAATTTGGG

GTACCCACTGTGGAGGCTTAAG ACACCTGAAGAACATGAATTGGAAACTGGAATAAAGTCAAAAGAAGCTCGGAAGTACATTTTTAACTGTTTAGATGA

CATGGCTCAG GTAAATATGTCTACAGACTTAGAGGGGACAGATATGTTAGCAGAGAAAGCAGATCGGAGAGAGTATATTGATCTTCTAAAGAAAATGCT

GACGATTGATGCAGATAAGAGAATCACGCCTCTGAAGACTCTTAACCACCAATTTGTGACGATGAGTCACCTCCTGGACTTTCCTCACAGCAGCCA CGT

TAAGTCCTGTTTCCAGAACATGGAGATCTGCAAGCGGAGGGTTCACATGTATGACACAGTGAGTCAGATCAAGAGTCCCTTCACTACACATGTCGCTCCA

AATACAAGCACAAATCTAACCATGAGCTTCAGCAACCAGCTCAACACAGTGCACAATCAG GCCAGTGTTCTAGCTTCCAGCTCTACTGCAGCAGCAGCT

ACCCTTTCTCTGGCTAATTCAGATGTCTCGCTGCTAAACTACCAATCGGCTTTGTACCCATCGTCGGCAGCGCCAGTTCCTGGAGTTGCCCAGCAGGGTG

TTTCCTTACAACCTGGAACCACCCAGATCTGCACTCAGACAGATCCATTCCAGCAAACATTTATAGTATGCCCACCTGCTTTTCAGA AGTCGGAGCAAG

CGGAAGGAAATGAGGGTCTGGGGGAAACTGAGAGCTCCCCGGGAGGCCAGGAGAGCGGTAGCGGTGTAAGCCAGGGAGAGACCACAGGGGGAGCGCAGGA

GCAGATTCACAATCC CTGGACTACAAGCAACAACAAAGCATTCTGGATTCCCTGTGAGGATGGATAATGCTGTGCCAATTGTACCCCAGGCGCCTGCTG

CTCAGCCGCTGCAGATCCAGTCAGGAGTACTCACACAG GGAAGCTGTACACCACTAATGGTAGCAACTCTCCACCCTCAAGTAGCCACCATCACGCCGC

AGTATGCGGTGCCCTTTACCCTGAGCTGCGCAGCAGGCCGGCCGGCGCTGGTTGAACAGACTGCTGCTGTACTG CAAGCCTGGCCTGGAGGAACCCAAC

AAATTCTCCTGCCTTCAGCCTGGCAGCAGCTGCCCGGGGTAGCTCTGCACAACTCTGTCCAGCCTGCTGCAGTGATTCCAGAGGCCATGGGGAGCAGCCA

ACAGCTAGCTGACTGGAG GAATGCCCACTCTCATGGCAACCAGTACAGCACTATTATGCAGCAGCCATCTTTGCTGACCAACCATGTGACCTTGGCCAC

TGCTCAGCCTCTGAATGTTGGTGTTGCCCATGTTGTCAGACAACAACAGTCTAGTTCCCTCCCTTCAAAGAAGAATAAGCAGTCTGCTCCAGTTTCATCC

AA ATCCTCTCTGGAAGTCCTGCCTTCTCAAGTTTATTCTCTGGTTGGGAGTAGTCCTCTTCGTACCACATCTTCTTATAATTCCCTAGTTCCTGTCCAA

GACCAGCATCAGCCAATCATCATTCCAGATACCCCCAGCCCTCCTGTGAGTGTCATCACTATCCGTAGTGACACTGATGAAGAAGAGGACAACAAATACA

AGCCCAATAG CTCGAGCCTGAAGGCGAGGTCTAATGTCATCAGTTATGTCACTGTCAATGATTCTCCAGACTCTGACTCCTCCCTGAGCAGCCCACATC

CCACAGACACTCTGAGTGCTCTGCGGGGCAACAGTGGGACCCTTCTGGAGGGACCTGGCAGACCTGCAGCAGATGGCATTGGCACCCGTACTATCATTGT

GCCTCCTTTGAAAACACAGCTTGGCGACTGCACTGTAGCAACACAGGCCTCAG GTCTCCTTAGCAGTAAGACCAAGCCAGTGGCCTCAGTGAGTGGGCA

GTCATCTGGATGCTGTATCACTCCCACGGGGTACCGGGCTCAGCGAGGGGGAGCCAGCGCGGTGCAGCCACTCAACCTTAGCCAG AACCAGCAGTCATC

GTCAGCTTCAACCTCGCAGGAAAGAAGCAGCAACCCTGCTCCCCGCAGACAGCAGGCATTTGTGGCCCCGCTCTCCCAAGCCCCCTACGCCTTCCAGCAT

GGCAGCCCACTGCACTCGACGGGGCACCCACACTTGGCCCCAGCCCCTGCTCACCTGCCAAGCCAGCCTCACCTGTATACGTACGCTGCCCCCACTTCTG

CTGCTGCATTGGGCTCCACCAGTTCCATTGCTCATCTGTTCTCCCCCCAGGGTTCCTCAAGGCATGCTGCAGCTTATACCACACACCCTAGCACTCTGGT

GCATCAGGTTCCTGTCAGTGTCGGGCCCAGCCTCCTCACTTCTGCCAGTGTGGCCCCTGCTCAGTACCAACACCAGTTTGCCACTCAGTCCTACATCGGG

TCTTCCCGAGGCTCAACAATTTACACTGGATACCCGCTGAGTCCTACCAAGATCAGTCAGTATTCTTACTTGTAGTTGATGAGCACGAGGAGGGCTCCGT

GGCTGCCTGCTACTAGCCCTGAGTTCTTAATGGGCTCTGGAGAGCACCTCCATTATCTCCTCTTGAAAGTTCCTAGCCAGCAGCGCGTTCTGCGGGGCCC

ACTGAAGCAGAAGGCTTTTCCCTGGGGAACAGCTCTCGGTGTTGACTGCATTGTTGCAGTCTCCCAAGTCTGCCCTGTTTTTTTAATTCTTTATTCTTGT

GACAGCATTTTTGGACGTTGGAAGAGCTCAGAAGCCCATCTTCTGCAGTTAC
Translation
 - UNI30340 - MASQLQVFSPPSVSSSAFCSAKKLKIEPSGWDVSGQSSNDKYYTHSKTLPATQGQASSSHQVANFNLPAYDQGLLLPAPAVEHIVV

TAADSSGSAATATFQSSQTLTHRSNVSLLEPYQKCGLKRKSEEVESNGSVQIIEEHPPLMLQNRTVVGAAATTTTVTTKSSSSSGEGDYQLVQHEILCSM

TNSYEVLEFLGRGTFGQVAKCWKRSTKEIVAIKILKNHPSYARQGQIEVSILSRLSSENADEYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSP

LPLKYIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKAVCSTYLQSRYYR - UNI25029 - RAPEIILGLPFCE

AIDMWSLGCVIAELFLGWPLYPGASEYDQ - UNI18385 - IRYISQTQGLPAEYLLSAGTKTTRFFNRDPNLGYPLWRLK TPEEHELETGIKSKEA

RKYIFNCLDDMAQ VNMSTDLEGTDMLAEKADRREYIDLLKKMLTIDADKRITPLKTLNHQFVTMSHLLDFPHSSH HVKSCFQNMEICKRRVHMYDTVS

QIKSPFTTHVAPNTSTNLTMSFSNQLNTVHNQ ASVLASSSTAAAATLSLANSDVSLLNYQSALYPSSAAPVPGVAQQGVSLQPGTTQICTQTDPFQQTF

IVCPPAFQK KSEQAEGNEGLGETESSPGGQESGSGVSQGETTGGAQEQIHNP PWTTSNNKAFWIPCEDG       
Transcript ENSMUST00000121324
Sequence
GCGGGAGGCTGGCGAGGCTCCGGCCGCAGGACGGGCGCGGGGACGGCTCCGGGGGGCGGGGGCCGGGGCCGGGGCCGGCTCGTGCGGGGGGTATGATGAC

CCGGCTGCGGGGCCCCGGATCGCCTCTCCTCCGCCGCCTCCTCGCGGCGGCCCCGACTCGAGGCTGAGAACTACACACACCGGCG - UNI30340 - G

TATGGCCTCACAGCTGCAGGTGTTTTCGCCCCCATCAGTGTCGTCGAGTGCCTTCTGCAGTGCAAAGAAACTGAAAATAGAGCCCTCTGGCTGGGATGTT

TCAGGACAGAGCAGCAACGACAAATACTATACCCACAGCAAAACCCTCCCAGCTACACAAGGGCAAGCCAGCTCCTCTCACCAGGTAGCAAATTTCAATC

TTCCTGCTTACGACCAGGGCCTCCTTCTCCCAGCTCCTGCCGTGGAGCATATTGTGGTAACAGCTGCTGATAGCTCAGGCAGCGCCGCTACAGCAACCTT

CCAAAGCAGCCAGACCCTGACTCACAGGAGCAACGTTTCTTTGCTTGAGCCATATCAAAAATGTGGATTGAAGAGAAAGAGTGAGGAAGTGGAGAGCAAC

GGTAGCGTGCAGATCATAGAAGAACACCCCCCTCTCATGCTGCAGAACAGAACCGTGGTGGGTGCTGCTGCCACGACCACCACTGTGACCACCAAGAGTA

GCAGTTCCAGCGGAGAAGGGGATTACCAGCTGGTCCAGCATGAGATCCTTTGCTCTATGACCAACAGCTATGAAGTCCTGGAGTTCCTAGGCCGGGGGAC

ATTTGGACAGGTGGCAAAGTGCTGGAAGCGGAGCACCAAGGAAATTGTGGCCATTAAGATCTTGAAGAACCACCCCTCCTATGCCAGACAAGGACAGATT

GAAGTGAGCATCCTTTCCCGCCTAAGCAGTGAAAATGCTGATGAGTATAACTTTGTCCGTTCTTATGAGTGTTTTCAGCACAAGAATCATACCTGCCTTG

TGTTTGAGATGTTGGAGCAGAACTTGTACGATTTTCTAAAGCAGAACAAGTTTAGCCCACTGCCACTCAAGTACATAAGACCAATCTTGCAGCAGGTGGC

CACAGCCCTGATGAAGCTGAAGAGTCTTGGTCTGATTCATGCTGACCTTAAACCTGAAAACATAATGCTAGTCGATCCAGTTCGCCAACCCTACCGAGTG

AAGGTCATTGACTTTGGTTCTGCTAGTCATGTTTCCAAAGCCGTGTGTTCAACCTACCTGCAATCACGCTACTACAG - UNI25029 - AGCTCCTGA

AATTATCCTTGGATTACCATTCTGTGAAGCTATTGACATGTGGTCACTGGGCTGTGTAATAGCTGAGCTGTTCCTGGGATGGCCTCTTTATCCTGGTGCT

TCAGAATACGATCAG - UNI18385 - ATTCGCTATATTTCACAAACACAAGGCCTGCCAGCTGAGTATCTTCTCAGTGCCGGAACAAAAACAACCAG

GTTTTTTAACAGAGATCCTAATTTGGGGTACCCACTGTGGAGGCTTAAG ACACCTGAAGAACATGAATTGGAAACTGGAATAAAGTCAAAAGAAGCTCG

GAAGTACATTTTTAACTGTTTAGATGACATGGCTCAG GTAAATATGTCTACAGACTTAGAGGGGACAGATATGTTAGCAGAGAAAGCAGATCGGAGAGA

GTATATTGATCTTCTAAAGAAAATGCTGACGATTGATGCAGATAAGAGAATCACGCCTCTGAAGACTCTTAACCACCAATTTGTGACGATGAGTCACCTC

CTGGACTTTCCTCACAGCAGCCA CGTTAAGTCCTGTTTCCAGAACATGGAGATCTGCAAGCGGAGGGTTCACATGTATGACACA GCCAGTGTTCTAGC

TTCCAGCTCTACTGCAGCAGCAGCTACCCTTTCTCTGGCTAATTCAGATGTCTCGCTGCTAAACTACCAATCGGCTTTGTACCCATCGTCGGCAGCGCCA

GTTCCTGGAGTTGCCCAGCAGGGTGTTTCCTTACAACCTGGAACCACCCAGATCTGCACTCAGACAGATCCATTCCAGCAAACATTTATAGTATGCCCAC

CTGCTTTTCAGA CTGGACTACAAGCAACAACAAAGCATTCTGGATTCCCTGTGAGGATGGATAATGCTGTGCCAATTGTACCCCAGGCGCCTGCTGCTC

AGCCGCTGCAGATCCAGTCAGGAGTACTCACACAG GGAAGCTGTACACCACTAATGGTAGCAACTCTCCACCCTCAAGTAGCCACCATCACGCCGCAGT

ATGCGGTGCCCTTTACCCTGAGCTGCGCAGCAGGCCGGCCGGCGCTGGTTGAACAGACTGCTGCTGTACTG CAAGCCTGGCCTGGAGGAACCCAACAAA

TTCTCCTGCCTTCAGCCTGGCAGCAGCTGCCCGGGGTAGCTCTGCACAACTCTGTCCAGCCTGCTGCAGTGATTCCAGAGGCCATGGGGAGCAGCCAACA

GCTAGCTGACTGGAG GAATGCCCACTCTCATGGCAACCAGTACAGCACTATTATGCAGCAGCCATCTTTGCTGACCAACCATGTGACCTTGGCCACTGC

TCAGCCTCTGAATGTTGGTGTTGCCCATGTTGTCAGACAACAACAGTCTAGTTCCCTCCCTTCAAAGAAGAATAAGCAGTCTGCTCCAGTTTCATCCAA 

ATCCTCTCTGGAAGTCCTGCCTTCTCAAGTTTATTCTCTGGTTGGGAGTAGTCCTCTTCGTACCACATCTTCTTATAATTCCCTAGTTCCTGTCCAAGAC

CAGCATCAGCCAATCATCATTCCAGATACCCCCAGCCCTCCTGTGAGTGTCATCACTATCCGTAGTGACACTGATGAAGAAGAGGACAACAAATACAAGC

CCAATAG CTCGAGCCTGAAGGCGAGGTCTAATGTCATCAGTTATGTCACTGTCAATGATTCTCCAGACTCTGACTCCTCCCTGAGCAGCCCACATCCCA

CAGACACTCTGAGTGCTCTGCGGGGCAACAGTGGGACCCTTCTGGAGGGACCTGGCAGACCTGCAGCAGATGGCATTGGCACCCGTACTATCATTGTGCC

TCCTTTGAAAACACAGCTTGGCGACTGCACTGTAGCAACACAGGCCTCAG GTCTCCTTAGCAGTAAGACCAAGCCAGTGGCCTCAGTGAGTGGGCAGTC

ATCTGGATGCTGTATCACTCCCACGGGGTACCGGGCTCAGCGAGGGGGAGCCAGCGCGGTGCAGCCACTCAACCTTAGCCAG AACCAGCAGTCATCGTC

AGCTTCAACCTCGCAGGAAAGAAGCAGCAACCCTGCTCCCCGCAGACAGCAGGCATTTGTGGCCCCGCTCTCCCAAGCCCCCTACGCCTTCCAGCATGGC

AGCCCACTGCACTCGACGGGGCACCCACACTTGGCCCCAGCCCCTGCTCACCTGCCAAGCCAGCCTCACCTGTATACGTACGCTGCCCCCACTTCTGCTG

CTGCATTGGGCTCCACCAGTTCCATTGCTCATCTGTTCTCCCCCCAGGGTTCCTCAAGGCATGCTGCAGCTTATACCACACACCCTAGCACTCTGGTGCA

TCAGGTTCCTGTCAGTGTCGGGCCCAGCCTCCTCACTTCTGCCAGTGTGGCCCCTGCTCAGTACCAACACCAGTTTGCCACTCAGTCCTACATCGGGTCT

TCCCGAGGCTCAACAATTTACACTGGATACCCGCTGAGTCCTACCAAGATCAGTCAGTATTCTTACTTGTAGTTGATGAGCACGAGGAGGGCTCCGTGGC

TGCCTGCTACTAGCCCTGAGTTCTTAATGGGCTCTG
Translation
 - UNI30340 - MASQLQVFSPPSVSSSAFCSAKKLKIEPSGWDVSGQSSNDKYYTHSKTLPATQGQASSSHQVANFNLPAYDQGLLLPAPAVEHIVV

TAADSSGSAATATFQSSQTLTHRSNVSLLEPYQKCGLKRKSEEVESNGSVQIIEEHPPLMLQNRTVVGAAATTTTVTTKSSSSSGEGDYQLVQHEILCSM

TNSYEVLEFLGRGTFGQVAKCWKRSTKEIVAIKILKNHPSYARQGQIEVSILSRLSSENADEYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSP

LPLKYIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKAVCSTYLQSRYYR - UNI25029 - RAPEIILGLPFCE

AIDMWSLGCVIAELFLGWPLYPGASEYDQ - UNI18385 - IRYISQTQGLPAEYLLSAGTKTTRFFNRDPNLGYPLWRLK TPEEHELETGIKSKEA

RKYIFNCLDDMAQ VNMSTDLEGTDMLAEKADRREYIDLLKKMLTIDADKRITPLKTLNHQFVTMSHLLDFPHSSH HVKSCFQNMEICKRRVHMYDT A

SVLASSSTAAAATLSLANSDVSLLNYQSALYPSSAAPVPGVAQQGVSLQPGTTQICTQTDPFQQTFIVCPPAFQT TGLQATTKHSGFPVRMDNAVPIVP

QAPAAQPLQIQSGVLTQ GSCTPLMVATLHPQVATITPQYAVPFTLSCAAGRPALVEQTAAVL QAWPGGTQQILLPSAWQQLPGVALHNSVQPAAVIPE

AMGSSQQLADWR RNAHSHGNQYSTIMQQPSLLTNHVTLATAQPLNVGVAHVVRQQQSSSLPSKKNKQSAPVSSK KSSLEVLPSQVYSLVGSSPLRTTS

SYNSLVPVQDQHQPIIIPDTPSPPVSVITIRSDTDEEEDNKYKPNS SSSLKARSNVISYVTVNDSPDSDSSLSSPHPTDTLSALRGNSGTLLEGPGRPA

ADGIGTRTIIVPPLKTQLGDCTVATQASG GLLSSKTKPVASVSGQSSGCCITPTGYRAQRGGASAVQPLNLSQ NQQSSSASTSQERSSNPAPRRQQAF

VAPLSQAPYAFQHGSPLHSTGHPHLAPAPAHLPSQPHLYTYAAPTSAAALGSTSSIAHLFSPQGSSRHAAAYTTHPSTLVHQVPVSVGPSLLTSASVAPA

QYQHQFATQSYIGSSRGSTIYTGYPLSPTKISQYSYL
Transcript ENSMUST00000118317
Sequence
CCGCCACCAAACGCCGGTTAAACGACCTCGGAGACTGCTGTGCGGAGAGGACTGGGAAACCGGTCCCCACACACTGTCCACGCTGGCTCCCCACGGAGGC

CCACCCACACCCGCGGCCCGGGGCAAGATGCAGTGATCTCAGCCCTCCCGCTCCTCCGCACTTCCGCCTCA - UNI30340 - GTATGGCCTCACAGC

TGCAGGTGTTTTCGCCCCCATCAGTGTCGTCGAGTGCCTTCTGCAGTGCAAAGAAACTGAAAATAGAGCCCTCTGGCTGGGATGTTTCAGGACAGAGCAG

CAACGACAAATACTATACCCACAGCAAAACCCTCCCAGCTACACAAGGGCAAGCCAGCTCCTCTCACCAGGTAGCAAATTTCAATCTTCCTGCTTACGAC

CAGGGCCTCCTTCTCCCAGCTCCTGCCGTGGAGCATATTGTGGTAACAGCTGCTGATAGCTCAGGCAGCGCCGCTACAGCAACCTTCCAAAGCAGCCAGA

CCCTGACTCACAGGAGCAACGTTTCTTTGCTTGAGCCATATCAAAAATGTGGATTGAAGAGAAAGAGTGAGGAAGTGGAGAGCAACGGTAGCGTGCAGAT

CATAGAAGAACACCCCCCTCTCATGCTGCAGAACAGAACCGTGGTGGGTGCTGCTGCCACGACCACCACTGTGACCACCAAGAGTAGCAGTTCCAGCGGA

GAAGGGGATTACCAGCTGGTCCAGCATGAGATCCTTTGCTCTATGACCAACAGCTATGAAGTCCTGGAGTTCCTAGGCCGGGGGACATTTGGACAGGTGG

CAAAGTGCTGGAAGCGGAGCACCAAGGAAATTGTGGCCATTAAGATCTTGAAGAACCACCCCTCCTATGCCAGACAAGGACAGATTGAAGTGAGCATCCT

TTCCCGCCTAAGCAGTGAAAATGCTGATGAGTATAACTTTGTCCGTTCTTATGAGTGTTTTCAGCACAAGAATCATACCTGCCTTGTGTTTGAGATGTTG

GAGCAGAACTTGTACGATTTTCTAAAGCAGAACAAGTTTAGCCCACTGCCACTCAAGTACATAAGACCAATCTTGCAGCAGGTGGCCACAGCCCTGATGA

AGCTGAAGAGTCTTGGTCTGATTCATGCTGACCTTAAACCTGAAAACATAATGCTAGTCGATCCAGTTCGCCAACCCTACCGAGTGAAGGTCATTGACTT

TGGTTCTGCTAGTCATGTTTCCAAAGCCGTGTGTTCAACCTACCTGCAATCACGCTACTACAG - UNI25029 - AGCTCCTGAAATTATCCTTGGAT

TACCATTCTGTGAAGCTATTGACATGTGGTCACTGGGCTGTGTAATAGCTGAGCTGTTCCTGGGATGGCCTCTTTATCCTGGTGCTTCAGAATACGATCA

G - UNI18385 - ATTCGCTATATTTCACAAACACAAGGCCTGCCAGCTGAGTATCTTCTCAGTGCCGGAACAAAAACAACCAGGTTTTTTAACAGAG

ATCCTAATTTGGGGTACCCACTGTGGAGGCTTAAG ACACCTGAAGAACATGAATTGGAAACTGGAATAAAGTCAAAAGAAGCTCGGAAGTACATTTTTA

ACTGTTTAGATGACATGGCTCAG GTAAATATGTCTACAGACTTAGAGGGGACAGATATGTTAGCAGAGAAAGCAGATCGGAGAGAGTATATTGATCTTC

TAAAGAAAATGCTGACGATTGATGCAGATAAGAGAATCACGCCTCTGAAGACTCTTAACCACCAATTTGTGACGATGAGTCACCTCCTGGACTTTCCTCA

CAGCAGCCA CGTTAAGTCCTGTTTCCAGAACATGGAGATCTGCAAGCGGAGGGTTCACATGTATGACACAGTGAGTCAGATCAAGAGTCCCTTCACTAC

ACATGTCGCTCCAAATACAAGCACAAATCTAACCATGAGCTTCAGCAACCAGCTCAACACAGTGCACAATCAG GCCAGTGTTCTAGCTTCCAGCTCTAC

TGCAGCAGCAGCTACCCTTTCTCTGGCTAATTCAGATGTCTCGCTGCTAAACTACCAATCGGCTTTGTACCCATCGTCGGCAGCGCCAGTTCCTGGAGTT

GCCCAGCAGGGTGTTTCCTTACAACCTGGAACCACCCAGATCTGCACTCAGACAGATCCATTCCAGCAAACATTTATAGTATGCCCACCTGCTTTTCAGA

 CTGGACTACAAGCAACAACAAAGCATTCTGGATTCCCTGTGAGGATGGATAATGCTGTGCCAATTGTACCCCAGGCGCCTGCTGCTCAGCCGCTGCAGA

TCCAGTCAGGAGTACTCACACAG GGAAGCTGTACACCACTAATGGTAGCAACTCTCCACCCTCAAGTAGCCACCATCACGCCGCAGTATGCGGTGCCCT

TTACCCTGAGCTGCGCAGCAGGCCGGCCGGCGCTGGTTGAACAGACTGCTGCTGTACTG CAAGCCTGGCCTGGAGGAACCCAACAAATTCTCCTGCCTT

CAGCCTGGCAGCAGCTGCCCGGGGTAGCTCTGCACAACTCTGTCCAGCCTGCTGCAGTGATTCCAGAGGCCATGGGGAGCAGCCAACAGCTAGCTGACTG

GAG GAATGCCCACTCTCATGGCAACCAGTACAGCACTATTATGCAGCAGCCATCTTTGCTGACCAACCATGTGACCTTGGCCACTGCTCAGCCTCTGAA

TGTTGGTGTTGCCCATGTTGTCAGACAACAACAGTCTAGTTCCCTCCCTTCAAAGAAGAATAAGCAGTCTGCTCCAGTTTCATCCAA ATCCTCTCTGGA

AGTCCTGCCTTCTCAAGTTTATTCTCTGGTTGGGAGTAGTCCTCTTCGTACCACATCTTCTTATAATTCCCTAGTTCCTGTCCAAGACCAGCATCAGCCA

ATCATCATTCCAGATACCCCCAGCCCTCCTGTGAGTGTCATCACTATCCGTAGTGACACTGATGAAGAAGAGGACAACAAATACAAGCCCAATAG CTCG

AGCCTGAAGGCGAGGTCTAATGTCATCAGTTATGTCACTGTCAATGATTCTCCAGACTCTGACTCCTCCCTGAGCAGCCCACATCCCACAGACACTCTGA

GTGCTCTGCGGGGCAACAGTGGGACCCTTCTGGAGGGACCTGGCAGACCTGCAGCAGATGGCATTGGCACCCGTACTATCATTGTGCCTCCTTTGAAAAC

ACAGCTTGGCGACTGCACTGTAGCAACACAGGCCTCAG GTCTCCTTAGCAGTAAGACCAAGCCAGTGGCCTCAGTGAGTGGGCAGTCATCTGGATGCTG

TATCACTCCCACGGGGTACCGGGCTCAGCGAGGGGGAGCCAGCGCGGTGCAGCCACTCAACCTTAGCCAG AACCAGCAGTCATCGTCAGCTTCAACCTC

GCAGGAAAGAAGCAGCAACCCTGCTCCCCGCAGACAGCAGGCATTTGTGGCCCCGCTCTCCCAAGCCCCCTACGCCTTCCAGCATGGCAGCCCACTGCAC

TCGACGGGGCACCCACACTTGGCCCCAGCCCCTGCTCACCTGCCAAGCCAGCCTCACCTGTATACGTACGCTGCCCCCACTTCTGCTGCTGCATTGGGCT

CCACCAGTTCCATTGCTCATCTGTTCTCCCCCCAGGGTTCCTCAAGGCATGCTGCAGCTTATACCACACACCCTAGCACTCTGGTGCATCAGGTTCCTGT

CAGTGTCGGGCCCAGCCTCCTCACTTCTGCCAGTGTGGCCCCTGCTCAGTACCAACACCAGTTTGCCACTCAGTCCTACATCGGGTCTTCCCGAGGCTCA

ACAATTTACACTGGATACCCGCTGAGTCCTACCAAGATCAGTCAGTATTCTTACTTGTAGTTGATGAGCACGAGGAGGGCTCCGTGGCTGCCTGCTACTA

GCCCTGAGTTCTTAATGGGCTCTGGAGAGCACCTCCATTATCTCCTCTTGAAAGTTCCTAGCCAGCAGCGCGTTCTGCGGGGCCCACTGAAGCAGAAGGC

TTTTCCCTGGGGAACAGCTCTCGGTGTTGACTGCATTGTTGCAGTCTCCCAAGTCTGCCCTGTTTTTTTAATTCTTTATTCTTGTGACAGCATTTTTGGA

CGTTGGAAGAGCTCAGAAGCCCATCTTCTGCAGTTACCAAGGAAGAAAGATCGTTCTGAAGTTACCCTCTGTCATACATTTGGTCTCTTTGACTTGGTTT

CTATAAATGTTTTTAAAATGAAGTAAAGCTCTTCTTTACGAGGGGAAATGCTGACTTGAAATCCTGTAACAGATGAGAAAGAGTCATTACTTTTTGTTTG

CTTAAAAAACTAAAACACAAGACTTCCTTGTCTTTTATTTTGAAAGCAGCTTAGCAAGGCTGTGCTTATGGCGTATGGAAACAGAGTGATTTCATTTTCA

TGTCGTGCTGTCCTTACTGGGCAGTTGTTAGAGTTTTAGTACAACGAGTACTGAAACCTGTGCAGCTGCTGCTGAGCTGCTCGCAGAGCAGCACTGAACA

GGCAGCCAGCGCTGCTGGGAAGGAAGGTGAGGGTGAGGACTGTGCCCACCAGGATTCATTCTAAATGAAGACCATGAGTTCAAGTCCTCCTCCTCTCTCT

AGTTTAACTTAAATTCTCCTTATAGAAAAGCCAGTGAGGTGGTAAGTGTATGGTGGTGGTTTGCATACAATAGTATGCAAAATCTCTCTCTAGAATGAGA

TACTGGCACTGATAAACATTGCCTAAGATTTCTATGAATTTTCAATAATACACGTCTGTGTTTTCCTCATCTCTCCCTTCTGTTTCATGTGACTTATTTG

AGGGGAAAACTAAAGAAACTAAAACCAGATAAGTTGTGTATAGCTTTTATACTTTAAAGTAGCTTCCTTTGTATGCCAACAGCAAATTGAATGCTCTCTT

ACTAAGACTTATGTAATAAGTGCATGTAGGAATTGCAGAAAATATTTTAAAAGTTTATTACTGAATTTAAAAATATTTTAGAAGTTTTGTAATGGTGGTG

TTTTAATATTTTGCATAATTAAATATGTACATATTGATTAGAAGAAATATAACAATTTTTCCTCTAACCCAAAATGTTATTTGTAATCAAATGTGTAGTG

ATTACACTTGAATTGTGTATTTAGTGTGTATCTGATCCTCCAGTGTTACCCCGGAGATGGATTATGTCTCCATTGTATTTAAACCAAAATGAACTGATAC

TTGTTGGAATGTATGTGAACTAATTGCAATTCTATTAGAGCATATTACTGTAGTGCTGAGAGAGCAGGGGCATTGCCTGCAGAGAGGAGACCTTGGGATT

GTTTTGCACAGGTGTGTCTGGTGAGGAGTTGTTCAGTGTGTGTCTTTTCCTTCCCCCTCTCCTCTCTCCCCTTATTGTAGTGCCTTATATGATAATGTAG

TGGTTAATAGAGTTTACAGTGAGCTTGCCTTAGGATGACCAGCAAGCCCCAGTGACCCCAAGCTGTTCGCTGGGATTTAACAGAGCAGGTTGAGTAGCTG

TGTTGTGTAAATGCGTTCGTGTTCTCAGTCTCCCTACCGACAGTGACAAGTCAAAGCCGCAGCTTTCCTCCTTAACTGCCACCTCTGTCCCGTTCCATTT

TGGATCTTCAGCTCAGTTCTCACAGAAGCATTCCCTAACGTGGCTCTCTCACTGTGCCTTGCTACCTGGCTTCTGTGAGAGTTCAGGAAGCAGGCGAGAA

GAGTGACGCCAGTGCTAAATATGCATATTTGAAGGTTTGTGCATCACTTAGGATGGGATTCCTTTTCTCTCCTCCATGTGATATGATAGTCCTTTCTGCA

TAGCTGTCGTTCCTGGTAAACTTTGCTTGGCTTTTTTTTTTTGTTTGTTTTTTGTTTTTTTTTTAAAGCATGTAACAGATGTGTTTATACCAAAGAGCCT

GTTGTATTGCTTAATATGTCCCCATACTACGAGAAGGGTTTTGTAGAACTACTGGTGACAAGAAGCTCACAGAAAGGTTTCTTAATTAGTGACGAATATG

AAAAAGAAAGCAAAACCTCTTGAATCTGAACAATTCCTGAGGTTTCTTTGGGACAACATGTTGTTCTTGGGGCCCTTCACACTGTAAAATTGTCCTAGTA

TTCAACCCCTCCATGGATTTGGGTCAAGTTGAAGGTACTAGGGGTGGGGACATTCTTGCCCGTGAGGGATTTGTGGGGAGAAGGTTAACCCTAAGCTACA

GATGTGGTCCACCTGAATTAAATTATATCAGAGTGGTAATTCTAGGATTGGTTCTGTGTAGGTGGTGTCAGGGAGGTGCAGGATGGAGATGGGAGATTTC

ATGGAACCCGGTCAGGAAAGCTCTGAACCAGGTGGAACACCGAGGGGCTGTCAACGAACTTGGAGTTTCTTCATCATGGGGAGGAAGAGTTTCCAGGGCA

GGGCAGGTAGTCAGTTTAGCCTGCCGGCAACGTGGTGTGTGTTGTCTTTTCTTTAATCATTATATTAAGCTGTGCGTTCAGCAGTCTGTTGGTTGAGATA

ACCACGCATCATTGTGTAGTTTGTCACTAGTGTTATACCGTTTATGTCATTCTGTGTGTGATCTTTGTGTTTCCTTTCCCCCAAGCATTCTGGGTTTTTC

CTATTTAAATACAGTTCTAGTTTCTAGGCAAACATTTTTTTTTTTAACCTTTTCTCTATAAGGGACAAGATTTATTGTTTTTATAGGAATGAGATGCAGG

GAAAAAACAAACCAACCCTGTCCCCACCTCCTCACCTCCCTAATCCAATAAGCAGTTATTGAAGATGGGAGTCTTAAATTTATGGGAAAAGAGGATGCCT

AGGAGTTTGCATCGTTACCTGAGACATCTGGCTAGCAGTGTGACTTTACAGACTTTGAGGTTGTCACTCTGCAAACTGACATTTCAGATTTTCCTAGATA

ACCCATCTGTGTCTGCTGAATGTGTATGCGCCAGACATAGTTTTACATTCATTCTGGCCTGGGGCTTAACATTGACTGCTTGCCCTGATGGCATGGAGGA

GAGCCCTACGAACATAGCGCTGACCTAGGTCAGCATTGCCTGACCTTGGAACAGCTTAAGGCTTTAAACCTTCTCTTAGAACGTGCATTTCCAGTTTCTC

CCTTCCCAGGTGAGAGAGGAACTGGAAGGGTTGCATAGGCACACACCAGGACACTTAGTCACTCCAGAGTCCCCAGTTGCAACTAGGAGGTGGTTACCCT

GTTAACCCCAGGAAGAAGAACCCCATTTCAAACAGTTCCGGCCATTGAGAGCCTGCTTTTGTGGTTGCTCATCCGTCATCATCCGCTAGAGGGGCTTAGC

CAGGCCAGCACAGTACTGGCTGTCCTATTCTGCATTAGTATGCAGGAATTTACTAGTTGAGATGGTTTGTTTTAGGATAGGAGATGAAATTGCCTCTCGG

TGACAGGAATGGCCAAGCCTGCTTTGTGTTTTTTTTTAACTGATGGATGGTGCAGCATGTCTCCACGTTTCCATGGTTGTTTGTTGCTAAACTTTATATA

ATGTGTGGTTTCAATTCAATTCAGCTTGAAAAATAATCTCACTATATGTAGCAGTACATTATATGTACATTATATGTAATGTTAGTATTTCTGCTTTGAA

TCCTTGATATTGCAATGGAATTCCTACTTTATTAAATGTATTTGATATGCTAGTTCCTGTGTGTGGTTAAACTTTTTTTCTTTCTCCCTTTTCTGGTTGT

GTGCTTCCTTTACAACAAGCTTCTAGAAACAGGTAGTTCTGAGAATTACTGATCTATGTTTGTAATGCAGGTGTACTTAGGGAGTATGTAAAATCATTTT

AACAAAAGAAATAGCTATTTAAAATTTAATACTAACTATGGGAAAAGGGTCCATTGTGTAAAACATAGTTTATCTTTGGATTCGTTGTTGTCTTTGGTTT

TACAAAGTAGCTTGTATTTTCAGTATTTTCTACATAATATGGTAAAAAAGTAGAGCAGTTGCAATGCATCAATAAAATGGGTAAATTTTCTGA
Translation
 - UNI30340 - MASQLQVFSPPSVSSSAFCSAKKLKIEPSGWDVSGQSSNDKYYTHSKTLPATQGQASSSHQVANFNLPAYDQGLLLPAPAVEHIVV

TAADSSGSAATATFQSSQTLTHRSNVSLLEPYQKCGLKRKSEEVESNGSVQIIEEHPPLMLQNRTVVGAAATTTTVTTKSSSSSGEGDYQLVQHEILCSM

TNSYEVLEFLGRGTFGQVAKCWKRSTKEIVAIKILKNHPSYARQGQIEVSILSRLSSENADEYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSP

LPLKYIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKAVCSTYLQSRYYR - UNI25029 - RAPEIILGLPFCE

AIDMWSLGCVIAELFLGWPLYPGASEYDQ - UNI18385 - IRYISQTQGLPAEYLLSAGTKTTRFFNRDPNLGYPLWRLK TPEEHELETGIKSKEA

RKYIFNCLDDMAQ VNMSTDLEGTDMLAEKADRREYIDLLKKMLTIDADKRITPLKTLNHQFVTMSHLLDFPHSSH HVKSCFQNMEICKRRVHMYDTVS

QIKSPFTTHVAPNTSTNLTMSFSNQLNTVHNQ ASVLASSSTAAAATLSLANSDVSLLNYQSALYPSSAAPVPGVAQQGVSLQPGTTQICTQTDPFQQTF

IVCPPAFQT TGLQATTKHSGFPVRMDNAVPIVPQAPAAQPLQIQSGVLTQ GSCTPLMVATLHPQVATITPQYAVPFTLSCAAGRPALVEQTAAVL QA

WPGGTQQILLPSAWQQLPGVALHNSVQPAAVIPEAMGSSQQLADWR RNAHSHGNQYSTIMQQPSLLTNHVTLATAQPLNVGVAHVVRQQQSSSLPSKKN

KQSAPVSSK KSSLEVLPSQVYSLVGSSPLRTTSSYNSLVPVQDQHQPIIIPDTPSPPVSVITIRSDTDEEEDNKYKPNS SSSLKARSNVISYVTVNDS

PDSDSSLSSPHPTDTLSALRGNSGTLLEGPGRPAADGIGTRTIIVPPLKTQLGDCTVATQASG GLLSSKTKPVASVSGQSSGCCITPTGYRAQRGGASA

VQPLNLSQ NQQSSSASTSQERSSNPAPRRQQAFVAPLSQAPYAFQHGSPLHSTGHPHLAPAPAHLPSQPHLYTYAAPTSAAALGSTSSIAHLFSPQGSS

RHAAAYTTHPSTLVHQVPVSVGPSLLTSASVAPAQYQHQFATQSYIGSSRGSTIYTGYPLSPTKISQYSYL
Transcript ENSMUST00000106845
Sequence
AGGACGGGCGCGGGGACGGCTCCGGGGGGCGGGGGCCGGGGCCGGGGCCGGCTCGTGCGGGGGGTATGATGACCCGGCTGCGGGGCCCCGGATCGCCTCT

CCTCCGCCGCCTCCTCGCGGCGGCCCCGACTCGAGGCTGAGAACTACACACACCGGCG - UNI30340 - GTATGGCCTCACAGCTGCAGGTGTTTTC

GCCCCCATCAGTGTCGTCGAGTGCCTTCTGCAGTGCAAAGAAACTGAAAATAGAGCCCTCTGGCTGGGATGTTTCAGGACAGAGCAGCAACGACAAATAC

TATACCCACAGCAAAACCCTCCCAGCTACACAAGGGCAAGCCAGCTCCTCTCACCAGGTAGCAAATTTCAATCTTCCTGCTTACGACCAGGGCCTCCTTC

TCCCAGCTCCTGCCGTGGAGCATATTGTGGTAACAGCTGCTGATAGCTCAGGCAGCGCCGCTACAGCAACCTTCCAAAGCAGCCAGACCCTGACTCACAG

GAGCAACGTTTCTTTGCTTGAGCCATATCAAAAATGTGGATTGAAGAGAAAGAGTGAGGAAGTGGAGAGCAACGGTAGCGTGCAGATCATAGAAGAACAC

CCCCCTCTCATGCTGCAGAACAGAACCGTGGTGGGTGCTGCTGCCACGACCACCACTGTGACCACCAAGAGTAGCAGTTCCAGCGGAGAAGGGGATTACC

AGCTGGTCCAGCATGAGATCCTTTGCTCTATGACCAACAGCTATGAAGTCCTGGAGTTCCTAGGCCGGGGGACATTTGGACAGGTGGCAAAGTGCTGGAA

GCGGAGCACCAAGGAAATTGTGGCCATTAAGATCTTGAAGAACCACCCCTCCTATGCCAGACAAGGACAGATTGAAGTGAGCATCCTTTCCCGCCTAAGC

AGTGAAAATGCTGATGAGTATAACTTTGTCCGTTCTTATGAGTGTTTTCAGCACAAGAATCATACCTGCCTTGTGTTTGAGATGTTGGAGCAGAACTTGT

ACGATTTTCTAAAGCAGAACAAGTTTAGCCCACTGCCACTCAAGTACATAAGACCAATCTTGCAGCAGGTGGCCACAGCCCTGATGAAGCTGAAGAGTCT

TGGTCTGATTCATGCTGACCTTAAACCTGAAAACATAATGCTAGTCGATCCAGTTCGCCAACCCTACCGAGTGAAGGTCATTGACTTTGGTTCTGCTAGT

CATGTTTCCAAAGCCGTGTGTTCAACCTACCTGCAATCACGCTACTACAG - UNI25029 - AGCTCCTGAAATTATCCTTGGATTACCATTCTGTGA

AGCTATTGACATGTGGTCACTGGGCTGTGTAATAGCTGAGCTGTTCCTGGGATGGCCTCTTTATCCTGGTGCTTCAGAATACGATCAG - UNI18385 

- ATTCGCTATATTTCACAAACACAAGGCCTGCCAGCTGAGTATCTTCTCAGTGCCGGAACAAAAACAACCAGGTTTTTTAACAGAGATCCTAATTTGGG

GTACCCACTGTGGAGGCTTAAG ACACCTGAAGAACATGAATTGGAAACTGGAATAAAGTCAAAAGAAGCTCGGAAGTACATTTTTAACTGTTTAGATGA

CATGGCTCAG GTAAATATGTCTACAGACTTAGAGGGGACAGATATGTTAGCAGAGAAAGCAGATCGGAGAGAGTATATTGATCTTCTAAAGAAAATGCT

GACGATTGATGCAGATAAGAGAATCACGCCTCTGAAGACTCTTAACCACCAATTTGTGACGATGAGTCACCTCCTGGACTTTCCTCACAGCAGCCA CGT

TAAGTCCTGTTTCCAGAACATGGAGATCTGCAAGCGGAGGGTTCACATGTATGACACAGTGAGTCAGATCAAGAGTCCCTTCACTACACATGTCGCTCCA

AATACAAGCACAAATCTAACCATGAGCTTCAGCAACCAGCTCAACACAGTGCACAATCAG GCCAGTGTTCTAGCTTCCAGCTCTACTGCAGCAGCAGCT

ACCCTTTCTCTGGCTAATTCAGATGTCTCGCTGCTAAACTACCAATCGGCTTTGTACCCATCGTCGGCAGCGCCAGTTCCTGGAGTTGCCCAGCAGGGTG

TTTCCTTACAACCTGGAACCACCCAGATCTGCACTCAGACAGATCCATTCCAGCAAACATTTATAGTATGCCCACCTGCTTTTCAGA CTGGACTACAAG

CAACAACAAAGCATTCTGGATTCCCTGTGAGGATGGATAATGCTGTGCCAATTGTACCCCAGGCGCCTGCTGCTCAGCCGCTGCAGATCCAGTCAGGAGT

ACTCACACAG CAAGCCTGGCCTGGAGGAACCCAACAAATTCTCCTGCCTTCAGCCTGGCAGCAGCTGCCCGGGGTAGCTCTGCACAACTCTGTCCAGCC

TGCTGCAGTGATTCCAGAGGCCATGGGGAGCAGCCAACAGCTAGCTGACTGGAG GAATGCCCACTCTCATGGCAACCAGTACAGCACTATTATGCAGCA

GCCATCTTTGCTGACCAACCATGTGACCTTGGCCACTGCTCAGCCTCTGAATGTTGGTGTTGCCCATGTTGTCAGACAACAACAGTCTAGTTCCCTCCCT

TCAAAGAAGAATAAGCAGTCTGCTCCAGTTTCATCCAA ATCCTCTCTGGAAGTCCTGCCTTCTCAAGTTTATTCTCTGGTTGGGAGTAGTCCTCTTCGT

ACCACATCTTCTTATAATTCCCTAGTTCCTGTCCAAGACCAGCATCAGCCAATCATCATTCCAGATACCCCCAGCCCTCCTGTGAGTGTCATCACTATCC

GTAGTGACACTGATGAAGAAGAGGACAACAAATACAAGCCCAATAG CTCGAGCCTGAAGGCGAGGTCTAATGTCATCAGTTATGTCACTGTCAATGATT

CTCCAGACTCTGACTCCTCCCTGAGCAGCCCACATCCCACAGACACTCTGAGTGCTCTGCGGGGCAACAGTGGGACCCTTCTGGAGGGACCTGGCAGACC

TGCAGCAGATGGCATTGGCACCCGTACTATCATTGTGCCTCCTTTGAAAACACAGCTTGGCGACTGCACTGTAGCAACACAGGCCTCAG GTCTCCTTAG

CAGTAAGACCAAGCCAGTGGCCTCAGTGAGTGGGCAGTCATCTGGATGCTGTATCACTCCCACGGGGTACCGGGCTCAGCGAGGGGGAGCCAGCGCGGTG

CAGCCACTCAACCTTAGCCAG AACCAGCAGTCATCGTCAGCTTCAACCTCGCAGGAAAGAAGCAGCAACCCTGCTCCCCGCAGACAGCAGGCATTTGTG

GCCCCGCTCTCCCAAGCCCCCTACGCCTTCCAGCATGGCAGCCCACTGCACTCGACGGGGCACCCACACTTGGCCCCAGCCCCTGCTCACCTGCCAAGCC

AGCCTCACCTGTATACGTACGCTGCCCCCACTTCTGCTGCTGCATTGGGCTCCACCAGTTCCATTGCTCATCTGTTCTCCCCCCAGGGTTCCTCAAGGCA

TGCTGCAGCTTATACCACACACCCTAGCACTCTGGTGCATCAGGTTCCTGTCAGTGTCGGGCCCAGCCTCCTCACTTCTGCCAGTGTGGCCCCTGCTCAG

TACCAACACCAGTTTGCCACTCAGTCCTACATCGGGTCTTCCCGAGGCTCAACAATTTACACTGGATACCCGCTGAGTCCTACCAAGATCAGTCAGTATT

CTTACTTGTAGTTGATGAGCACGAGGAGGGCTCCGTGGCTGCCTGCTACTAGCCCTGAGTTCTTAATGGGCTCTGGAGAGCACCTCCATTATCTCCTCTT

GAAAGTTCCTAGCCAGCAGCGCGTTCTGCGGGGCCCACTGAAGCAGAAGGCTTTTCCCTGGGGAACAGCTCTCGGTGTTGACTGCATTGTTGCAGTCTCC

CAAGTCTGCCCTGTTTTTTTAATTCTTTATTCTTGTGACAGCATTTTTGGACGTTGGAAGAGCTCAGAAGCCCATCTTCTGCAGTTAC
Translation
 - UNI30340 - MASQLQVFSPPSVSSSAFCSAKKLKIEPSGWDVSGQSSNDKYYTHSKTLPATQGQASSSHQVANFNLPAYDQGLLLPAPAVEHIVV

TAADSSGSAATATFQSSQTLTHRSNVSLLEPYQKCGLKRKSEEVESNGSVQIIEEHPPLMLQNRTVVGAAATTTTVTTKSSSSSGEGDYQLVQHEILCSM

TNSYEVLEFLGRGTFGQVAKCWKRSTKEIVAIKILKNHPSYARQGQIEVSILSRLSSENADEYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSP

LPLKYIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKAVCSTYLQSRYYR - UNI25029 - RAPEIILGLPFCE

AIDMWSLGCVIAELFLGWPLYPGASEYDQ - UNI18385 - IRYISQTQGLPAEYLLSAGTKTTRFFNRDPNLGYPLWRLK TPEEHELETGIKSKEA

RKYIFNCLDDMAQ VNMSTDLEGTDMLAEKADRREYIDLLKKMLTIDADKRITPLKTLNHQFVTMSHLLDFPHSSH HVKSCFQNMEICKRRVHMYDTVS

QIKSPFTTHVAPNTSTNLTMSFSNQLNTVHNQ ASVLASSSTAAAATLSLANSDVSLLNYQSALYPSSAAPVPGVAQQGVSLQPGTTQICTQTDPFQQTF

IVCPPAFQT TGLQATTKHSGFPVRMDNAVPIVPQAPAAQPLQIQSGVLTQ QAWPGGTQQILLPSAWQQLPGVALHNSVQPAAVIPEAMGSSQQLADWR

 RNAHSHGNQYSTIMQQPSLLTNHVTLATAQPLNVGVAHVVRQQQSSSLPSKKNKQSAPVSSK KSSLEVLPSQVYSLVGSSPLRTTSSYNSLVPVQDQH

QPIIIPDTPSPPVSVITIRSDTDEEEDNKYKPNS SSSLKARSNVISYVTVNDSPDSDSSLSSPHPTDTLSALRGNSGTLLEGPGRPAADGIGTRTIIVP

PLKTQLGDCTVATQASG GLLSSKTKPVASVSGQSSGCCITPTGYRAQRGGASAVQPLNLSQ NQQSSSASTSQERSSNPAPRRQQAFVAPLSQAPYAFQ

HGSPLHSTGHPHLAPAPAHLPSQPHLYTYAAPTSAAALGSTSSIAHLFSPQGSSRHAAAYTTHPSTLVHQVPVSVGPSLLTSASVAPAQYQHQFATQSYI

GSSRGSTIYTGYPLSPTKISQYSYL
Transcript ENSMUST00000029438
Sequence
AGGACGGGCGCGGGGACGGCTCCGGGGGGCGGGGGCCGGGGCCGGGGCCGGCTCGTGCGGGGGGTATGATGACCCGGCTGCGGGGCCCCGGATCGCCTCT

CCTCCGCCGCCTCCTCGCGGCGGCCCCGACTCGAGGCTGAGAACTACACACACCGGCG - UNI30340 - GTATGGCCTCACAGCTGCAGGTGTTTTC

GCCCCCATCAGTGTCGTCGAGTGCCTTCTGCAGTGCAAAGAAACTGAAAATAGAGCCCTCTGGCTGGGATGTTTCAGGACAGAGCAGCAACGACAAATAC

TATACCCACAGCAAAACCCTCCCAGCTACACAAGGGCAAGCCAGCTCCTCTCACCAGGTAGCAAATTTCAATCTTCCTGCTTACGACCAGGGCCTCCTTC

TCCCAGCTCCTGCCGTGGAGCATATTGTGGTAACAGCTGCTGATAGCTCAGGCAGCGCCGCTACAGCAACCTTCCAAAGCAGCCAGACCCTGACTCACAG

GAGCAACGTTTCTTTGCTTGAGCCATATCAAAAATGTGGATTGAAGAGAAAGAGTGAGGAAGTGGAGAGCAACGGTAGCGTGCAGATCATAGAAGAACAC

CCCCCTCTCATGCTGCAGAACAGAACCGTGGTGGGTGCTGCTGCCACGACCACCACTGTGACCACCAAGAGTAGCAGTTCCAGCGGAGAAGGGGATTACC

AGCTGGTCCAGCATGAGATCCTTTGCTCTATGACCAACAGCTATGAAGTCCTGGAGTTCCTAGGCCGGGGGACATTTGGACAGGTGGCAAAGTGCTGGAA

GCGGAGCACCAAGGAAATTGTGGCCATTAAGATCTTGAAGAACCACCCCTCCTATGCCAGACAAGGACAGATTGAAGTGAGCATCCTTTCCCGCCTAAGC

AGTGAAAATGCTGATGAGTATAACTTTGTCCGTTCTTATGAGTGTTTTCAGCACAAGAATCATACCTGCCTTGTGTTTGAGATGTTGGAGCAGAACTTGT

ACGATTTTCTAAAGCAGAACAAGTTTAGCCCACTGCCACTCAAGTACATAAGACCAATCTTGCAGCAGGTGGCCACAGCCCTGATGAAGCTGAAGAGTCT

TGGTCTGATTCATGCTGACCTTAAACCTGAAAACATAATGCTAGTCGATCCAGTTCGCCAACCCTACCGAGTGAAGGTCATTGACTTTGGTTCTGCTAGT

CATGTTTCCAAAGCCGTGTGTTCAACCTACCTGCAATCACGCTACTACAG - UNI25029 - AGCTCCTGAAATTATCCTTGGATTACCATTCTGTGA

AGCTATTGACATGTGGTCACTGGGCTGTGTAATAGCTGAGCTGTTCCTGGGATGGCCTCTTTATCCTGGTGCTTCAGAATACGATCAG - UNI18385 

- ATTCGCTATATTTCACAAACACAAGGCCTGCCAGCTGAGTATCTTCTCAGTGCCGGAACAAAAACAACCAGGTTTTTTAACAGAGATCCTAATTTGGG

GTACCCACTGTGGAGGCTTAAG ACACCTGAAGAACATGAATTGGAAACTGGAATAAAGTCAAAAGAAGCTCGGAAGTACATTTTTAACTGTTTAGATGA

CATGGCTCAG GTAAATATGTCTACAGACTTAGAGGGGACAGATATGTTAGCAGAGAAAGCAGATCGGAGAGAGTATATTGATCTTCTAAAGAAAATGCT

GACGATTGATGCAGATAAGAGAATCACGCCTCTGAAGACTCTTAACCACCAATTTGTGACGATGAGTCACCTCCTGGACTTTCCTCACAGCAGCCA CGT

TAAGTCCTGTTTCCAGAACATGGAGATCTGCAAGCGGAGGGTTCACATGTATGACACAGTGAGTCAGATCAAGAGTCCCTTCACTACACATGTCGCTCCA

AATACAAGCACAAATCTAACCATGAGCTTCAGCAACCAGCTCAACACAGTGCACAATCAG GCCAGTGTTCTAGCTTCCAGCTCTACTGCAGCAGCAGCT

ACCCTTTCTCTGGCTAATTCAGATGTCTCGCTGCTAAACTACCAATCGGCTTTGTACCCATCGTCGGCAGCGCCAGTTCCTGGAGTTGCCCAGCAGGGTG

TTTCCTTACAACCTGGAACCACCCAGATCTGCACTCAGACAGATCCATTCCAGCAAACATTTATAGTATGCCCACCTGCTTTTCAGA CTGGACTACAAG

CAACAACAAAGCATTCTGGATTCCCTGTGAGGATGGATAATGCTGTGCCAATTGTACCCCAGGCGCCTGCTGCTCAGCCGCTGCAGATCCAGTCAGGAGT

ACTCACACAG GGAAGCTGTACACCACTAATGGTAGCAACTCTCCACCCTCAAGTAGCCACCATCACGCCGCAGTATGCGGTGCCCTTTACCCTGAGCTG

CGCAGCAGGCCGGCCGGCGCTGGTTGAACAGACTGCTGCTGTACTG CAAGCCTGGCCTGGAGGAACCCAACAAATTCTCCTGCCTTCAGCCTGGCAGCA

GCTGCCCGGGGTAGCTCTGCACAACTCTGTCCAGCCTGCTGCAGTGATTCCAGAGGCCATGGGGAGCAGCCAACAGCTAGCTGACTGGAG GAATGCCCA

CTCTCATGGCAACCAGTACAGCACTATTATGCAGCAGCCATCTTTGCTGACCAACCATGTGACCTTGGCCACTGCTCAGCCTCTGAATGTTGGTGTTGCC

CATGTTGTCAGACAACAACAGTCTAGTTCCCTCCCTTCAAAGAAGAATAAGCAGTCTGCTCCAGTTTCATCCAA ATCCTCTCTGGAAGTCCTGCCTTCT

CAAGTTTATTCTCTGGTTGGGAGTAGTCCTCTTCGTACCACATCTTCTTATAATTCCCTAGTTCCTGTCCAAGACCAGCATCAGCCAATCATCATTCCAG

ATACCCCCAGCCCTCCTGTGAGTGTCATCACTATCCGTAGTGACACTGATGAAGAAGAGGACAACAAATACAAGCCCAATAG CTCGAGCCTGAAGGCGA

GGTCTAATGTCATCAGTTATGTCACTGTCAATGATTCTCCAGACTCTGACTCCTCCCTGAGCAGCCCACATCCCACAGACACTCTGAGTGCTCTGCGGGG

CAACAGTGGGACCCTTCTGGAGGGACCTGGCAGACCTGCAGCAGATGGCATTGGCACCCGTACTATCATTGTGCCTCCTTTGAAAACACAGCTTGGCGAC

TGCACTGTAGCAACACAGGCCTCAG GTCTCCTTAGCAGTAAGACCAAGCCAGTGGCCTCAGTGAGTGGGCAGTCATCTGGATGCTGTATCACTCCCACG

GGGTACCGGGCTCAGCGAGGGGGAGCCAGCGCGGTGCAGCCACTCAACCTTAGCCAG AACCAGCAGTCATCGTCAGCTTCAACCTCGCAGGAAAGAAGC

AGCAACCCTGCTCCCCGCAGACAGCAGGCATTTGTGGCCCCGCTCTCCCAAGCCCCCTACGCCTTCCAGCATGGCAGCCCACTGCACTCGACGGGGCACC

CACACTTGGCCCCAGCCCCTGCTCACCTGCCAAGCCAGCCTCACCTGTATACGTACGCTGCCCCCACTTCTGCTGCTGCATTGGGCTCCACCAGTTCCAT

TGCTCATCTGTTCTCCCCCCAGGGTTCCTCAAGGCATGCTGCAGCTTATACCACACACCCTAGCACTCTGGTGCATCAGGTTCCTGTCAGTGTCGGGCCC

AGCCTCCTCACTTCTGCCAGTGTGGCCCCTGCTCAGTACCAACACCAGTTTGCCACTCAGTCCTACATCGGGTCTTCCCGAGGCTCAACAATTTACACTG

GATACCCGCTGAGTCCTACCAAGATCAGTCAGTATTCTTACTTGTAGTTGATGAGCACGAGGAGGGCTCCGTGGCTGCCTGCTACTAGCCCTGAGTTCTT

AATGGGCTCTGGAGAGCACCTCCATTATCTCCTCTTGAAAGTTCCTAGCCAGCAGCGCGTTCTGCGGGGCCCACTGAAGCAGAAGGCTTTTCCCTGGGGA

ACAGCTCTCGGTGTTGACTGCATTGTTGCAGTCTCCCAAGTCTGCCCTGTTTTTTTAATTCTTTATTCTTGTGACAGCATTTTTGGACGTTGGAAGAGCT

CAGAAGCCCATCTTCTGCAGTTAC
Translation
 - UNI30340 - MASQLQVFSPPSVSSSAFCSAKKLKIEPSGWDVSGQSSNDKYYTHSKTLPATQGQASSSHQVANFNLPAYDQGLLLPAPAVEHIVV

TAADSSGSAATATFQSSQTLTHRSNVSLLEPYQKCGLKRKSEEVESNGSVQIIEEHPPLMLQNRTVVGAAATTTTVTTKSSSSSGEGDYQLVQHEILCSM

TNSYEVLEFLGRGTFGQVAKCWKRSTKEIVAIKILKNHPSYARQGQIEVSILSRLSSENADEYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSP

LPLKYIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKAVCSTYLQSRYYR - UNI25029 - RAPEIILGLPFCE

AIDMWSLGCVIAELFLGWPLYPGASEYDQ - UNI18385 - IRYISQTQGLPAEYLLSAGTKTTRFFNRDPNLGYPLWRLK TPEEHELETGIKSKEA

RKYIFNCLDDMAQ VNMSTDLEGTDMLAEKADRREYIDLLKKMLTIDADKRITPLKTLNHQFVTMSHLLDFPHSSH HVKSCFQNMEICKRRVHMYDTVS

QIKSPFTTHVAPNTSTNLTMSFSNQLNTVHNQ ASVLASSSTAAAATLSLANSDVSLLNYQSALYPSSAAPVPGVAQQGVSLQPGTTQICTQTDPFQQTF

IVCPPAFQT TGLQATTKHSGFPVRMDNAVPIVPQAPAAQPLQIQSGVLTQ GSCTPLMVATLHPQVATITPQYAVPFTLSCAAGRPALVEQTAAVL QA

WPGGTQQILLPSAWQQLPGVALHNSVQPAAVIPEAMGSSQQLADWR RNAHSHGNQYSTIMQQPSLLTNHVTLATAQPLNVGVAHVVRQQQSSSLPSKKN

KQSAPVSSK KSSLEVLPSQVYSLVGSSPLRTTSSYNSLVPVQDQHQPIIIPDTPSPPVSVITIRSDTDEEEDNKYKPNS SSSLKARSNVISYVTVNDS

PDSDSSLSSPHPTDTLSALRGNSGTLLEGPGRPAADGIGTRTIIVPPLKTQLGDCTVATQASG GLLSSKTKPVASVSGQSSGCCITPTGYRAQRGGASA

VQPLNLSQ NQQSSSASTSQERSSNPAPRRQQAFVAPLSQAPYAFQHGSPLHSTGHPHLAPAPAHLPSQPHLYTYAAPTSAAALGSTSSIAHLFSPQGSS

RHAAAYTTHPSTLVHQVPVSVGPSLLTSASVAPAQYQHQFATQSYIGSSRGSTIYTGYPLSPTKISQYSYL

For any suggestions or comments, please send an email to unitrap@crg.es