Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000008843 (Cldn13)
Chromosomal location
Chr 5: 135390120 - 135391396 (-)
Description
claudin 13 Gene [Source:MGI (curated);Acc:Cldn13-001]
RefSeq_dna
NM_020504 
RefSeq_peptide
NP_065250.1 
UniGene
Mm.86652 
MGI
MGI:1913102 
Uniprot/SWISSPROT
Q9Z0S4 
Uniprot/SPTREMBL
Q547B2 
Human Ortholog
not available
Omim not available
UniTrap UNI21022
Vector Insertion
Chr 5: 135390361 - 135390571
Public Clones CMHD-GT_447F1-3 (cmhd) CMHD-GT_514F11-3 (cmhd)
Private Clones OST345721 (lexicon) OST330818 (lexicon) OST325699 (lexicon) OST169865 (lexicon)
OST130947 (lexicon)
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000008987
Sequence
AGGGTCCTGTGTCAACTGCTGTGCTCACACTTGCTGGAGCTCGACATTTGACTACCTAGATCATCATTGGTGACAGTGGCCTCTCATACGTGCTGGCCCC

CGATACTTTAAAATTCCATCCTCGGCTCTTGGAATCCTGCATCTCTACAGCTGGACCCCTGACTCGTCCTGGTCCTGCCATTAGCAGACTCTGAGCCATG

GTCGTCAGCAAACAAGAGGCCATCAGCTTCTCTGTGACTTCACTGGGTTGGGTGGGTGCCATTGTGAGCTGCGTGCTGCCCGTTTGGAGGGTGACCTTTC

CAGATGATGAGACAGACCCAGATGCCACCATTTGGGAGGGTCTGTGGCACATATGCCAGGTTCGGGAAAACAGGTGGATACAGTGTACACTGTATGACAC

CCGGATACTGGTAGCACAGGACATAAAAGTGTCTCGAGTCTTTATGGTCATCTGTACCATTGGAACCTGGCTGGGATTGCTGCTCTGTGTGCTTGGGGAT

TGGCGCATCAATTGTTTCATGAATTTTACTATTGAAGAGAACCTCTTGAAAGTAGCCGGTGGGATGTTTCTTAGTGTTGGCCTTCTGATGCTGGTACCCC

TGTCCTGGGTAACACACAACATCATCCATGGCTTCTTTAACCCATTGCTTGGCTTCTCGAAGAAAGTACAGATGGGCTCTTCACTCTCCCTGGCCTGGAC

CAGCTCCCTGCTGCTGTTGCTGGGAGGCATCCTGCTCTGTGTCAACATCCCAGTATGCAGAGACTTTCCCCGTTGCATTGAGACCCCTAGTGCTAGACCT

TCAGGAGCCAACAACGATACCTTAG - UNI21022 - ATGTTTGATGGCCAGCACACTCACGTCTGGAGGGGAAAACTTCCTCAAGAGGCCTCTCTCC

AGGTTCTAGAATCATTGAACTGGAGGGAGGAAAGACAGGTCTACGGAGCTGCCCACAAGCTGTGTAGTGGACTCTGGATGCGGCTAGCTGTGTCAGCACC

ATGCTGAGGTGGGCTTCTTGGTGCTGAAGCTGCCCGAGTCTCCTATCTAAGGGACCCCAATAAAGTCATTGTTCCCCTAG
Translation
MVVSKQEAISFSVTSLGWVGAIVSCVLPVWRVTFPDDETDPDATIWEGLWHICQVRENRWIQCTLYDTRILVAQDIKVSRVFMVICTIGTWLGLLLCVLG

DWRINCFMNFTIEENLLKVAGGMFLSVGLLMLVPLSWVTHNIIHGFFNPLLGFSKKVQMGSSLSLAWTSSLLLLLGGILLCVNIPVCRDFPRCIETPSAR

PSGANNDTLD - UNI21022 - DV

For any suggestions or comments, please send an email to unitrap@crg.es