Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000009030 (Pdcl)
Chromosomal location
Chr 2: 37205596 - 37214773 (-)
Description
phosducin-like Gene [Source:MGI (curated);Acc:Pdcl-001]
RefSeq_dna
NM_026176 
RefSeq_peptide
NP_080452.2 
UniGene
Mm.30709 Mm.399908 Mm.461269 
MGI
MGI:1914716 
Uniprot/SWISSPROT
Q9DBX2 
Uniprot/SPTREMBL
A2AVP2 A2AVP3 Q3UZN6 Q923E8 
Human Ortholog
ENSG00000136940 (PDCL)
Omim not available
UniTrap UNI4773
Vector Insertion
Chr 2: 37207903 - 37211155
Public Clones AW0599 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112940
Sequence
AGCTTTTTCTCTGTCGCTCAAGGCTTTCGGCCACTTCTCTTTCTCTAGGCGAGCGTCCTTTGTTGGTGACAGGAGCTGCTAGTCTAGAAGGAGCAGACTG

AGCGAGGCGAGGTAACTAACTGCGCAGGCGTCGGCAAGGAGGAAGCGGCGGGCCTAGACATGGGTGGGGCAGGAGTTTACGCGCCTTGGGCGAACTACTT

TGCTTCCCGGCTCCTGGATCCCAATTCCTCTGTACTTCTCAAATTCCTTTGGAGACTCGGAGCGTCCCTCCTCAGTACCGCCCTCTTCACTGTGCCCTCC

CCTGCCCTGTCCTCCTCGCTACTCCGCCTCCTCAGCCCCACCTTCCTTATGGCTCCGCCTTCTCCACTCCGTCCTTACAGCTCTGCTTTACTTAACATCC

TGTCCCTGCCCTTTTGTCCCATAAGCTCCGCCTTCCTGGAAGCTTAGCCCCGCCCTTCTGTGTTCCACTTGTGCAGCCCTGTCTTCTTCACTGTCCTACT

TTCTCTTAACACTCTTAACTGCCTCTCTTGGAAGCCTTTCACTGGCCCTGCCCATATCACTGCTCCTCCTTTTCTGTGCCTCTCCTTAGCTCCACCCTCT

TCATGATCCTCCACCTCTTCAAGTTTACTATCCCCACTTGAGGTTTACTTTCTGCACTGCGGGTGCATGCCACTTCTGTCTGCCAGTGTTCTCACCTCTC

AGCAGCCCAGTCTCCTCAGTACACTCCTCCTCTTCTGGCCCCGTTTTTCACTCATCGGACCGAGTTGTGGCCCTCTGGCACATCCCAGACAAGGAAATTG

TAAAAGTTTTCTTCCTTCCCCTGGTGCTGGCACTTTCCTCTTGGTTGCTGTTCAGCGTGCACAGTGCTCTGTCCTGACTGGAATCTGCTGTGTGGGAGAG

AG GCACCATGACAACCCTGGATGATAAGTTACTGGGGGAGAAATTACAGTACTACTACAGCACCAGCGAGGATGAGGACAGTGACCATGAAGACAAAGA

CAGAGGCAGGGGAGCACCAGCCATTAGTTCCACACCTGCAGAGGCTGAGCTGGCAGGCGAAGGCATCTCCATCAATACAG GTCCAAAAGGTGTGATCAA

TGACTGGCGCCGCTTCAAGCAGTTGGAGACAGAGCAGAGGGAGGAGCAGTGCCGGGAGATGGAGCGGCTGATCAAAAAGCTGTCTATGAGCTGCAGGTCC

CATCTGGATGAAGAGGAGGAGCAACAGAAACAGAAGGACCTCCAGGAGAAAATCAGTGGGAAG - UNI4773 - ATGACTCTAAAGGAGTTTGGTACA

AAGGACAAGAACTTGGATGATGAAGAGTTTTTGCAGCAGTATCGGAAGCAGAGGATGGAAGAGATGCGGCAGCAGTTTCATAAAGGGCCCCAATTCAAGC

AAGTTTTTGAAATCCCCAGTGGAGAAGGGTTTTTAGATATGATTGATAAAGAACAAAAAAGCACACTTATCATGGTTCATATTTATGAAGATGGCGTCCC

AGGGACTGAAGCCATGAATGGCTGCATGATCTGCCTTGCCACAGAGTACCCCGCCGTCAAATTCTGTCGGGTGAGGAGCTCAGTTATTGGGGCCAGTAGT

CGTTTTACCCGGAATGCCCTTCCTGCTCTGCTCATCTACAAGGCGGGTGAATTGATTGGCAATTTTGTTCGAGTCACTGACCAGCTGGGGGAAGATTTCT

TTGCTGTAGACCTTGAAGCTTTCCTGCAGGAATTTGGATTGCTCCCAGAAAAGGAAGTCTTGGTGCTGACATCTGTGCGAAACTCTGCCACCTGTCACAG

TGAAGACAGCGATCTGGAAATAGATTGAACTGATAATCTAGTTCCGTAGCTATCTCATTGTTTGGGCTGGAGGACACATGTCTGTATTTATTTCTGTCCT

TCCTGTGTCTTCTGGCTTTACAGCTGTTCTTTGTAGTCTCATTTAGTATGTGAAAAGTCAAGAAATTCTTAGATTAAATCAGAATGCTGACTCACTTTGT

AGCTAGCAGTAAAGTGACTTCAAATTATATAAGCAGGAAACTAGGTTCTTGAGCTGTTTACTTCTCTAGCGTGACATCTCTGATACTGTTTCCAGTCAAT

ATTGACATGGCACCCTTGCAGGCAATGTCTTGAAAATTGTCTTCTGATGACCTCAGAATTCTACCAGTTCTGAGAGTAGAATTCCCTAGTGAGTGTGTTC

TGTGCAATGTAAACAGTGCATTTCCATAATCACTTGATTGCAAATCATGTTTACTTGCAATCAGATGCATAGCTGTACTTTTTTTCTCTAGATCTGTCTC

TACCAGGGTCCATACAAGGTTGGGAATGTAGCTCGGTGGTGAACTCTTACTATGCACATGGCCCCAAGATACCTGATTCCTAGCACTGTCAAGACTAAAG

GTTCCAGATGGTGCCTGGTGCTGTAGTTAGCAGTGGCCTCTGCTGTGGCGGTCAGTGGTCCAGTCCAGCATAATGAACAGGAAAGGATGGTTTTTGCTGA

CTGCTGTCATGTTGGGAGGCAAGCATCTTATTGACTGACATTGGTGTGTGTGGAGCTTGAAAACCTCAGTGGGAGGATCTTTCTGTACTCCTGCTCATCA

GTATCTCTTCCTGTTATTAACAAGGCGACTTCTTGTTTAACCTCAGCTTTTTTTAAATGCTTTTTTGCCTATTAGGAAAAAAAAATCATATTTAGTAGAG

GAAAATTGGCCAAAATAAAGATGTAAAAATGGTTTAAAAATGTAATTCTGCCACCTAAATACTATATGTTTTGGTATAGTTCATATATAGGTTTTTTTTT

TTTAATGTATTCATTGGCTTTTGTTTGTCTTTAAATGACACTGGGATAATTCTGAGCATAGTGTCTGATATTATGGTCAGCTACTAACATCAGATGTTTT

TCATGTTATTAAATACTCTTCTGTAACATTTTAATAGCTGTTGATATTTCCACTGATAGATATACTGTAATATGCTTGGTGGTTGGTTTTTAGAAAGATG

GCAAACTTTTTTATTATGAACCTTTTATTATGAAATGTGTCCCTCATAGAACATACAATAAAAATTAAGCT
Translation
 MTTLDDKLLGEKLQYYYSTSEDEDSDHEDKDRGRGAPAISSTPAEAELAGEGISINTG GPKGVINDWRRFKQLETEQREEQCREMERLIKKLSMSCRS

HLDEEEEQQKQKDLQEKISGK - UNI4773 - MTLKEFGTKDKNLDDEEFLQQYRKQRMEEMRQQFHKGPQFKQVFEIPSGEGFLDMIDKEQKSTLIM

VHIYEDGVPGTEAMNGCMICLATEYPAVKFCRVRSSVIGASSRFTRNALPALLIYKAGELIGNFVRVTDQLGEDFFAVDLEAFLQEFGLLPEKEVLVLTS

VRNSATCHSEDSDLEID
Transcript ENSMUST00000009174
Sequence
ACTTCTCTTTCTCTAGGCGAGCGTCCTTTGTTGGTGACAGGAGCTGCTAGTCTAGAAGGAGCAGACTGAGCGAGGCGAG GCACCATGACAACCCTGGAT

GATAAGTTACTGGGGGAGAAATTACAGTACTACTACAGCACCAGCGAGGATGAGGACAGTGACCATGAAGACAAAGACAGAGGCAGGGGAGCACCAGCCA

TTAGTTCCACACCTGCAGAGGCTGAGCTGGCAGGCGAAGGCATCTCCATCAATACAG GTCCAAAAGGTGTGATCAATGACTGGCGCCGCTTCAAGCAGT

TGGAGACAGAGCAGAGGGAGGAGCAGTGCCGGGAGATGGAGCGGCTGATCAAAAAGCTGTCTATGAGCTGCAGGTCCCATCTGGATGAAGAGGAGGAGCA

ACAGAAACAGAAGGACCTCCAGGAGAAAATCAGTGGGAAG - UNI4773 - ATGACTCTAAAGGAGTTTGGTACAAAGGACAAGAACTTGGATGATGA

AGAGTTTTTGCAGCAGTATCGGAAGCAGAGGATGGAAGAGATGCGGCAGCAGTTTCATAAAGGGCCCCAATTCAAGCAAGTTTTTGAAATCCCCAGTGGA

GAAGGGTTTTTAGATATGATTGATAAAGAACAAAAAAGCACACTTATCATGGTTCATATTTATGAAGATGGCGTCCCAGGGACTGAAGCCATGAATGGCT

GCATGATCTGCCTTGCCACAGAGTACCCCGCCGTCAAATTCTGTCGGGTGAGGAGCTCAGTTATTGGGGCCAGTAGTCGTTTTACCCGGAATGCCCTTCC

TGCTCTGCTCATCTACAAGGCGGGTGAATTGATTGGCAATTTTGTTCGAGTCACTGACCAGCTGGGGGAAGATTTCTTTGCTGTAGACCTTGAAGCTTTC

CTGCAGGAATTTGGATTGCTCCCAGAAAAGGAAGTCTTGGTGCTGACATCTGTGCGAAACTCTGCCACCTGTCACAGTGAAGACAGCGATCTGGAAATAG

ATTGAACTGATAATCTAGTTCCGTAGCTATCTCATTGTTTGGGCTGGAGGACACATGTCTGTATTTATTTCTGTCCTTCCTGTGTCTTCTGGCTTTACAG

CTGTTCTTTGTAGTCTCATTTAGTATGTGAAAAGTCAAGAAATTCTTAGATTAAATCAGAATGCTGACTCACTTTGTAGCTAGCAGTAAAGTGACTTCAA

ATTATATAAGCAGGAAACTAGGTTCTTGAGCTGTTTACTTCTCTAGCGTGACATCTCTGATACTGTTTCCAGTCAATATTGACATGGCACCCTTGCAGGC

AATGTCTTGAAAATTGTCTTCTGATGACCTCAGAATTCTACCAGTTCTGAGAGTAGAATTCCCTAGTGAGTGTGTTCTGTGCAATGTAAACAGTGCATTT

CCATAATCACTTGATTGCAAATCATGTTTACTTGCAATCAGATGCATAGCTGTACTTTTTTTCTCTAGATCTGTCTCTACCAGGGTCCATACAAGGTTGG

GAATGTAGCTCGGTGGTGAACTCTTACTATGCACATGGCCCCAAGATACCTGATTCCTAGCACTGTCAAGACTAAAGGTTCCAGATGGTGCCTGGTGCTG

TAGTTAGCAGTGGCCTCTGCTGTGGCGGTCAGTGGTCCAGTCCAGCATAATGAACAGGAAAGGATGGTTTTTGCTGACTGCTGTCATGTTGGGAGGCAAG

CATCTTATTGACTGACATTGGTGTGTGTGGAGCTTGAAAACCTCAGTGGGAGGATCTTTCTGTACTCCTGCTCATCAGTATCTCTTCCTGTTATTAACAA

GGCGACTTCTTGTTTAACCTCAGCTTTTTTTAAATGCTTTTTTGCCTATTAGGAAAAAAAAATCATATTTAGTAGAGGAAAATTGGCCAAAATAAAGATG

TAAAAATGGTTTAAAAATGTAATTCTGCCACCTAAATACTATATGTTTTGGTATAGTTCATATATAGGTTTTTTTTTTTTAATGTATTCATTGGCTTTTG

TTTGTCTTTAAATGACACTGGGATAATTCTGAGCATAGTGTCTGATATTATGGTCAGCTACTAACATCAGATGTTTTTCATGTTATTAAATACTCTTCTG

TAACATTTTAATAGCTGTTGATATTTCCACTGATAGATATACTGTAATATGCTTGGTGGTTGGTTTTTAGAAAGATGGCAAACTTTTTTATTATGAACCT

TTTATTATGAAATGTGTCCCTCATAGAACATACAATAAAAATTAAGCTAAAAAGATATTTAAAAGCCATACAGTTTTACTACTGATAATTATGTCACCAT

TTTTATAGATCTCTTTATAGCTTTATGTGTATGTGTATATTTATAAAATTCATTGTCATTCAAGTTTTTTTCCTTTTAGTTATTCTTTATATGTTCTTGT

GTCAGTGGAGAAGAAATGTAGTCTGGAAGTAAATATTAGCTTTAGTATGCACACTTGAGTTTTTTGGTTGCTCAGAAACTAACTGTAAATGAGTCTTGAA

AGTGTCTGTTGGATTTAATCAACAAAAACAGTTGTCATTTTCTGACTAAGGAGCTTATTGTAGAAGTGAAGAAAATCATTAGGAACAGAGAAAGCTGATG

TAAGTATTCTAGTTTTTTTCTTTCCAATCCTTCTGTCCCCATTCTTAATAACATTGATAGTTACTGAATTCTGTGTCCTACTTTATGTAATAGTACATAC

TAAAATACTTTGCTATATTGTAAAAGTTCACCATTTAAATAAATCATACCATATTGACTC
Translation
 MTTLDDKLLGEKLQYYYSTSEDEDSDHEDKDRGRGAPAISSTPAEAELAGEGISINTG GPKGVINDWRRFKQLETEQREEQCREMERLIKKLSMSCRS

HLDEEEEQQKQKDLQEKISGK - UNI4773 - MTLKEFGTKDKNLDDEEFLQQYRKQRMEEMRQQFHKGPQFKQVFEIPSGEGFLDMIDKEQKSTLIM

VHIYEDGVPGTEAMNGCMICLATEYPAVKFCRVRSSVIGASSRFTRNALPALLIYKAGELIGNFVRVTDQLGEDFFAVDLEAFLQEFGLLPEKEVLVLTS

VRNSATCHSEDSDLEID

For any suggestions or comments, please send an email to unitrap@crg.es