Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000009418 (Nav1)
Chromosomal location
Chr 1: 137335450 - 137584682 (-)
Description
neuron navigator 1 Gene [Source:MGI Symbol;Acc:MGI:2183683]
RefSeq_dna
NM_173437 
RefSeq_peptide
NP_775613.1 
UniGene
Mm.387276 Mm.34977 Mm.475259 Mm.454364 
MGI
MGI:2183683 
Uniprot/SWISSPROT
Q8CH77 
Uniprot/SPTREMBL
Q3TZ81 Q8CB55 
Human Ortholog
ENSG00000134369 (NAV1)
Omim not available
UniTrap UNI19444
Vector Insertion
Chr 1: 137504482 - 137584495
Public Clones (ggtc) IST14539H6 (tigm) IST13562D8 (tigm) IST14226D2 (tigm) IST13873C4 (tigm)
IST14012D2 (tigm) IST14429D12 (tigm) IST12814C6 (tigm) IST13082G2 (tigm)
IST12144G5 (tigm) IST11330B5 (tigm)
Private Clones OST391034 (lexicon) OST370207 (lexicon) OST274167 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24202
Vector Insertion
Chr 1: 137433877 - 137481131
Public Clones CMHD-GT_430H9-3 (cmhd) IST14874C11 (tigm)
Private Clones OST231064 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15035
Vector Insertion
Chr 1: 137369309 - 137429292
Public Clones D064A05 (ggtc) D064B05 (ggtc) D062H05 (ggtc) (ggtc) PST12580-NL (escells)
IST14517C2 (tigm) IST10613E12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15235
Vector Insertion
Chr 1: 137362415 - 137364367
Public Clones PST11107-NL (escells)
Private Clones OST38199 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112103
Sequence
AGTGAGAGGCTGAAGGCCGGAGCGCGCAGCGCCGGCTGAGACTCGCGCGGGGAGCCGGCTGGGCCCCGGGAAACCCGGGAAACTTTCTGATCGCGAGGAC

AGGACGCCCTGCGTTGCGCTGCTCGGGCGATGCGCGATTCTGCGCGGCGGCGGCGCGGACCCACAACCCGGGACCTGAAGCGCTCCG - UNI19444 -

 GATCCTAGTGCCGCCCTACCTCTGCTGCTGACCATGAGTGGGATGGCCAACGTGAATTCTGCCAGCCGCCCACACTATGCTTCCTCTATCCCCGTGCCT

CGAGCCTCCTCCCAGACCAGGATTCACACCCCAGGCGCATCTCCCCAGCTGCGGCCTCGCCAACAGGCTGACCTGGCCCTGAGTCCCCAGCGAGGAGCCT

CCCCAAGACGGGGCAAGGCTGCAGTCTCTTCTAGAAACTCATCCCCCAAGGCTTACAGGGGAAGAGGAACCCCCAGGGCTGCCGGGCCAGCCAGAGAACT

GGCTGGGAGTGTAGAAAGCCTTCCCAGCTCCCCCTGGAACAGCCCCAGGGTAACCCCCAAAACAGCCCTCTCCAGTCAGGCAGGATCCAGAAGAGCTGGG

GAGACACAAAGCACCCAGAGGAAGAAGACCCAGGAAGGAATTCCAGTTCGACACACCAGAGGAAGGAGCCCACCCCAGTCAAGCTGTTATGGAGAAACAC

AAATTCCAGGGCCTCCTGAAGGTCGGATGCCTCCTGGCTGCCAGGGAAAAGATCAAAGAAACATCATCTCCAAACCCCCTAGGTGTCTGGAGCCGGATGA

AGGGGAAGCTTCGGGGACTTCCTCTCCAGTGTGCAGCCCCGTGCAGAGCATGCGGTCCTCAGCTACTCCTGGAGTCATTAGCTTTTCCTCAGCCCATCCG

CAGAGTCAACCAATCACAGCCACAGTAGCCCCCTTCCAGTACAGGTGAGCAGGGGGGCAGGCAGGGAGGGAAAGGGGGAACTGTGCCGAGATCAAGGGCC

AAACTAGAGATCAGAGGCTTTAGTGAACAATGAGTGGAGAACACAGGGTCAGAAGTTAGGAAAGGGGATGGCTGGAGACATGGGAGTGTGGTAAACTGAG

ATAGGACTATAATCTAAAGCCTGTTTTTTCTCCCCTCTGGGGCCTTGACAAGAACCAGGGACTCGTGAGAGTATCCTAAAGCGGCCATTTCACACTCTCT

TGGAAATGATGAGTCTATATTTGGGTATTAGAGATGTTTAAGCAGCCAGATACACAGGCAGGTGCATCAGCAGGTGCTTTAGACCGGCCAAATTTGTGTA

GGCTGTTTGCCACCACCGTATGTTAGACAAACGGTGTTGTCTTGAGCGCTGAGTCTTCAGTTGCTTGAGCAAAGACCTAACTGTGCTGCTCTCCTAGCAC

TCTTGTGTCTGTCTGTCTGTCTGTCCATCTCTCCTCCTCTCACCTGCTTGTTTGCAGTGCTTGTCATGCGGCCTTATGCCTGTTTAAATGCGTGGCGGAT

TGTTGGTCAGTACTACTTCTTAAGTTGCAAGGCAGGTACTGTTGTCATTGGCGGTGGCAGTACATTAGCAGCAGCGTGGTCAACGTGCCAACCTCCCCAG

CTTGCACACATGGCAAGCTAAGTGCATAGAATAACACTTAGCCAACTAGGCTTTTTAAG
Translation
 - UNI19444 - MSGMANVNSASRPHYASSIPVPRASSQTRIHTPGASPQLRPRQQADLALSPQRGASPRRGKAAVSSRNSSPKAYRGRGTPRAAGPA

RELAGSVESLPSSPWNSPRVTPKTALSSQAGSRRAGETQSTQRKKTQEGIPVRHTRGRSPPQSSCYGETQIPGPPEGRMPPGCQGKDQRNIISKPPRCLE

PDEGEASGTSSPVCSPVQSMRSSATPGVISFSSAHPQSQPITATVAPFQYR
Transcript ENSMUST00000040599
Sequence
GCAGCACGGATCGGCTAGCCGGGGGACAGAGACAAGATCCCAGCATCACAACACGACCTGGCTTCGATGGAGCCGCTGGTCTTCTATCGTTCCTTTGACT

GATTTAAATTTTTTAATTTATATTCTCCCCGCCCCGCCCCTTTTCCTTCGACCCCGCCCCATCAACCCGCTATTTCCTTGCCTTTTCCTCTTCCCCGGCT

TCCTTCTCCGCATTTCTTTCCCTTTCGCCCTCCGCTCGCCCCCTTGCTCCCTCCCCTTCCTCTCCCCTTCCTCCGCGGTTTCTTCCGTCCTCCCCCCCAT

TCCGCCCCCTCCTCTCCCGGCACTACCGCCCCCTCCCCCGCCCCGTGCCTGCAGACGCGCGGATCGTCCATGCGCTCCTCGCAGGCAGAATGCTGGGCAG

CAGCGTCAAGAGCGTGCAGCCCGAGGTGGAGCTGAGCGGCGGCAGCGGCAGCGGCGGCGACGAGGGCGCGGACGAGTCTCGGGGAGCCAGCAGAAAGGCA

GCCGCGGCGGACGGCAGAGGCATGCTGCCCAAGCGCGCCAAGGCGGCAGGAGGCAGTGGCAGTATGGCCAAGGCCAGTGCAGCGGAGCTGAAGGTCTTCA

AGTCCGGCAGCGTGGACAGTCGTGTCCCCGGCGGGCTGCCTACCTCCAACCTGCGCAAACAGAAGTCGCTCACCAACCTCTCGTTTCTCACGGACTCCGA

GAAAAAGCTGCAGCTGTATGAGCCTGAGTGGAGTGATGATATGGCCAAAGCACCCAAGGGTTTGGGCAAACTGGGGCCCAAGGGCCGCGAGACTCCTCTG

ATGTCCAAGACGCTGTCCAAGTCTGAGCATTCGCTCTTCCAACCCAAAGGTGGCTCAACCGGCGGCGCCAAGACCCCACTGGCTCCGCTAGCGCCCAGCC

TAGGCAAACCTAGCCGGATTCCTCGGGGACCCTATGCGGAGGTCAAGCCTCTCAGCAAGGCGCCTGAGGCAGCGGTAAGCGATGATGGCAAATCGGATGA

CGAACTGCTTTCCAGCAAGGCTAAAGCGCAAAAGGGCTCAGGGACTGTGCCCTCTGCCAAGGGCCAGGAGGAGCGGGCCTTCCTCAAGGTGGACCCCGAG

CTTGTGGTTACCGTGCTGGGCGACCTAGAACAGCTACTCTTCAGCCAGATGCTAG - UNI24202 - ATCCAGAGTCGCAGAGAAAGAGAACAGTACA

GAACGTTCTGGATCTCCGACAGAACCTGGAAGAAACCATGTCCAGCCTGCGAGGCTCCCAGGTGACTCACAG - UNI15035 - CTCCCTGGAGATGC

CTTGTTACGACAGCGATGACGCCAACCCCCGAAGCGTGTCCAGTCTCTCCAACCGCTCCTCTCCGCTCTCTTGGCGCTACGGCCAGTCTAGTCCCCGGCT

GCAGGCTGGCGACGCACCCTCTGTTGGGGGGAGCTGTCGTTCCGAGGGGCCACCGGCCTGGTACATGCATGGCGAGCGGGCACACTACTCCCACACCATG

CCGATGCGGAGCCCCAGCAAACTCAGCCACATCTCTCGCCTGGAGTTGGTGGAGTCCCTGGACTCTGACGAGGTGGACCTCAAATCCGGCTACATGAGTG

ACAGTGACCTCATGGGCAAGACCATGACAGAAGACGATGACATCACAACGGG - UNI15035 - CTGGGATGAAAGCAGCTCCATTAGCAGTGGGCTC

AGCGATGCCTCCGACAACCTCAGCTCAGAAGAGTTCAATGCCAGCTCCTCACTCAACTCCCTCCCAACCACTCCCACTGCCTCCCGCAGGAGCTCCACTA

TAGTG - UNI15035 - TTACGCACAGACTCGGAGAAGCGCTCCCTGGCGGAGAGTGGGCTCAACTGGTTCAGTGAGTCAGAGGAGAAGACCCCTAAA

AAACTGGAGTACGACAGTGGTAGCCTGAAGATGGAACCTGGGACTTCAAAGTGGCGGAGAGAGAGACCAGAGAGCTGCGATGACGCATCCAAGGGCGGAG

AACTGAAAAAGCCCATCAGCCTGGGACACCCAGGGTCCTTGAAAAAGGGCAAGACCCCTCCGGTGGCTGTCACCTCTCCCATCACTCACACCGCCCAGAG

TGCCCTCAAAGTCGCAG GCAAACCTGAAGGCAAAGCTACAGACAAGGGTAAACTCGCAGTGAAGAACACTGGGCTACAACGCTCCTCTTCTGATGCTGG

CCGGGACCGCCTGAGTGATGCTAAGAAGCCCCCCTCAGGCATTGCTCGGCCCTCTACTTCAGGATCCTTTGGTTATAAGAAGCCTCCCCCTGCTACTGGC

ACAGCCACTGTCATGCAGACCGGTAGCTCAGCCACCCTCAGCAAGATCCAGAAGTCCTCAGGGATCCCTGTGAAGCCAGTAAACGGGCGCAAGACGAGTT

TAGACGTGTCCAACAGTGTAGAGCCCGGATTTCTCGCCCCTGGAGCACGGTCCAACATCCAGTATCGCAGCCTACCCAGGCCAGCCAAGTCCAGTTCTAT

GAGTGTGACTGGGCGTGGTGGACCTCGGCCTGTTAGCAGCAGCATTGACCCCAGCCTCCTCAGCACCAAGCAGGGTGGCCTTACACCCTCCAGACTGAAG

GAACCTTCCAAGGTCGCCAGTGGTCGGAGCACTCCAGCCCCTGTCAATCAGACAGATCGGGAAAAGGAGAAGGCCAAAGCCAAGGCTGTGGCCCTGGACT

CAGACAACATCTCCTTGAAGAGCATAGGCTCCCCAGAAAGCACTCCCAAGAACCAAGCAAGCCACCCTCCAGCCACCAAGTTAGCAGAGCTGCCACCAAC

CCCTCTCAG GGCCACAGCTAAAAGCTTTGTCAAGCCACCCTCGCTAGCCAATCTAGACAAAGTCAACTCCAACAGTTTGGATCTACCATCTTCCAGCGA

CACCCATGCTTCCAAGGTCCCAGATCTGCATGCTCCGAGCTCATCAACTGGGGGCCCTCTCCCTTCTTGCTTCACTCCCAGCCCAGCACCCATCCTCAAT

ATTAACTCAGCCAGCTTCTCCCAGGGCCTGGAGCTAATGAGTGGTTTCAGTGTCCCAAAGGAGACCCGCATGTACCCCAAACTCTCAGGCCTGCACAGGA

GCATGGAGTCCCTCCAGATGCCAATGAGCCTGCCCAGTGCCTTCCCCAGCAGCGCCCCCATCCCTACCCCACCTACTGCCCCATCAGAGGAAGACACAGA

AGAGCTGCCCTGGAGTGGAAGCCCCAGGGCTGGACAATTGGACAG CAGTCAGCGAGATCGGAATACCCTCCCCAAGAAAGGGCTCAG - UNI15235 

- GTACCAGCTTCAGTCCCAGGAGGAGACCAAGGAGAGGCGGCACTCCCACACTGCCGGTGGGCTTCCAGAATCCGACGACCAGGCAGAGCTGCCATCCC

CCCCTGCTCTCTCCATGTCCTTGAGTGCAAAGGGCCAGCTTACCAACATAG - UNI15235 - TGAGTCCCACTGCGGCCACCACGCCAAGAATCACC

CGATCCAACAGCATCCCCACCCACGAGGCGGCCTTCGAGCTGTACAGCGGCTCCCAAATGGGGAGCACCCTGTCCCTGGCCGAGAGACCCAAGGGAATGA

TTCGGTCAGGATCCTTCCGAGACCCCACGGATGATG - UNI15235 - TTCATGGCTCGGTGCTGTCTCTGGCCTCCAGTGCTTCTTCTACCTACTCC

TCA GCTGAGGAGAGGATGCAATCTGAG CAAATTCGGAAGCTTCGTAGGGAGCTGGAGTCGTCCCAGGAAAAGGTGGCCACCCTGACATCTCAGCTGTC

TGCCAAC GCTAACCTAGTGGCCGCTTTCGAGCAGAGCCTGGTGAATATGACATCCCGCCTGCGACACCTGGCAGAGACGGCCGAGGAGAAG GACACCG

AGCTGTTGGATTTGCGAGAAACTATAGACTTCCTGAAGAAAAAGAATTCCGAGGCCCAGGCAGTCATCCAGGGAGCGTTAAATGCCTCAGAAGCCACGCC

CAAAG AACTCCGGATCAAGAGGCAGAATTCCTCAGATAGCATCTCCAGCCTCAACAGCATCACCAGCCATTCCAGCATCGGCAGCAGCAAAGATGCTGA

TGCCAAGAAGAAAAAGAAGAAGAGTTGG GTTTATGAG CTTCGGAGTTCCTTCAACAAAGCCTTCAGTATTAAAAAGGGTCCCAAGTCAGCCTCCTCCT

ACTCTGACATTGAAGAGATTGCCACACCTGACTCCTCAGCCCCATCATCCCCCAAACTCCAACACGGCTCCACTGAGACTGCCTCCCCCTCCATCAAGTC

CTCCACCTCATCCTCTGTGGGCACCGAGGTCACCGA GACCCCTGCTCATTCAGTCCCCCACACTAGACTGTTCCAAGCCAATGAAGAGGAGGAGCCAGA

GAAGAAGGAGGTATCAGAACTGCGCTCTGAACTATGGGAAAAAGAGATGAAGCTCACGGATATCCGGTTGGAGGCCCTCAACTCTGCCCACCAGCTGGAC

CAGCTTCGGGAGACCATGCACAATATGCAG TTGGAGGTGGACCTGCTGAAAGCAGAGAATGACCGGCTGAAGGTTGCCCCCGGCCCCTCCTCAGGCTGC

ACTCCAGGGCAGGTCCCTGGGTCATCGGCTCTGTCGTCCCCTCGACGTTCCCTGGGCCTTGCACTCAGCCATCCTTTCAGTCCTAGTCTCACAGACACAG

 ACCTCTCACCCATGGATGGCATCAGCACCTGTGGTTCAAAGGAAGAGGTGACCCTGCGGGTGGTGGTCCGGATGCCGCCCCAGCACATCATCAAAGGG 

GACTTAAAGCAGCAGGAGTTCTTCCTGGGTTGCAGCAAGGTCAGTGGCAAAGTTGACTGGAAGATGCTGGATGAAGCCGTTTTCCAAGTGTTCAAG GAC

TACATTTCTAAAATGGACCCAGCCTCAACCCTGGGACTGAGCACTGAGTCCATACATGGCTATAGCCTCAGCCACGTGAAACGAGTGCTGGATGCTGAGC

CCCCAGAGATGCCTCCTTGCCGCCGAGGTGTCAATAACATATCAGTCGCTCTCAAAG GTCTGAAAGAGAAGTGTGTCGACAGCCTGGTGTTCGAGACGC

TTATCCCCAAGCCCATGATGCAGCACTACATCAGCCTCCTGCTCAAGCACCGGCGCCTGGTGCTCTCCGGCCCCAGTGGCACCGGCAAGACCTACTTGAC

CAATCGGCTAGCCGAGTACCTGGTGGAGCGCTCCGGCCGCGAGGTCACGGATGGCATCGTCAGCACTTTCAACATGCACCAGCAGTCTTGCAAG GATCT

GCAACTGTACCTCTCCAACCTAGCCAACCAGATAGACCGGGAAACAGGGATAGGGGATGTGCCCTTGGTGATCCTCCTGGATGATCTGAGTGAAGCAGGC

TCCATCAGTGAGCTGGTCAATGGGGCCCTCACCTGCAAGTATCACAAATG TCCCTACATTATAGGTACCACCAATCAGCCTGTAAAAATGACACCCAAC

CATGGCTTGCACTTGAGCTTCAG GATGCTGACCTTCTCGAACAATGTGGAACCAGCCAATGGCTTTCTGGTCCGTTACCTGCGGAGGAAGTTGGTAGAG

TCAGACAGTGACGTCAATGCTAACAAGGAAGAGCTGCTTCGGGTGCTGGACTGGGTGCCCAAGCTGTGGTATCACCTCCACACCTTCCTGGAGAAGCACA

GCACCTCGGACTTCCTCATTG GCCCTTGCTTCTTCCTGTCCTGTCCCATTGGCATCGAGGACTTCCGGACCTGGTTCATTGACCTGTGGAACAATTCCA

TCATCCCCTATCTACAGGAAGGAGCCAAGGATGGGATCAAG GTTCATGGACAGAAAGCTGCTTGGGAAGACCCGGTGGAATGGGTCCGAGACACTCTTC

CCTGGCCGTCGGCCCAACAAGACCAATCAAAGCTCTACCACCTGCCCCCGCCTTCTGTGGGCCCCCACAGCACTGCCTCACCCCCGGAGGACAGGACAGT

CAAAGACAGCACTCCAAACTCCCTCGACTCAGATCCCCTG ATGGCCATGCTACTGAAACTCCAAGAAGCTGCCAACTACATTGAGTCACCAGATCGAGA

GACTATCCTGGACCCCAACCTCCAGGCGACACTCTGAGGGCCCGGCAGTCACTGTCACCCTGGAGGGCAGAAGGCTGGCTTCAGCATCATTAGCTCTCCT

CTGCCCTCTTCCTTCATAGCTCTGGCTCACCAGCCTCGCCAAGAGAACAGGAGGGAAGAAGAGGGCAGGAGGAGGGATGGGTTCTCGGTGCTGAACCTTT

GAGAACTTCCTACTAGGAATTGGAGGGGGTGGAGTTTGAGAACTCCGTGCCCCTTAACTACATTTGCTGGCCTCCTCTTACGACTTAGGAGAAAAGATGA

TTCTGGTCTTTTCTTCAAGTTTTGTTTCACCTACAAACTCTTGGGCTTTCTGGGGAGGGATTCGGAAGATATAAACAGACAAACAAAAACAAACAAACCA

ACTACAGCAGTTCCAAGCTCGTTCTCACAAACACCTCTGAGACAGTCACATGTGGGCAAATCTAAGGGAGGCAGGAAGCTCTACAGACTTTCTTGCAAAC

CCTTCCCAGTTCTGTCGACACTGCCAACAACCTCCCCGCCAGAGACCTGGCCAGAGCCAAGAAAAGAGAAGCATGTGGTTTAACAGAAAAACAAAACAAA

ACAAAACAAAAAATATATGTGTAAATCAACCTGTAGAAGGTAAAAACGGCAATGGAAAAGATGAAGCTGGAAGGAGGGGCCCAGTTGCCAAGATGGAACG

AGAGCTGCCAGATCTTGCCTTCTGGATGACAAGAGGGGACATTGCAAGATGGCTGCCAGTCTAAAACGTCACCAGACCACAAGAGTAACATCACAGCCTT

CGAAGAAAGGCCACAAGCTGTCTTTCTGCCCTCTAACTGAACATGCATGAAAAGTCAATAAACCCTACTTTTTAATTTTTAAATTTTTATTTCTATTTTT

TCCTTCCATTTGCCTATTTATTTGTCCCTCACCTCCAGTTTCCTCACATCAATAAGATACTTGGGTTTCCTTCCAGGGGATAGTTTTGCTTTCCAAGTGG

GTTTTCTTTGGAGAATTTAATTCTATAATATTGGTACAAGTTAGACACCTCCCATGCCACTGTCCCTGGCATCCTTGGGGCTTACATGGGACAAGAAACA

TTGGCTCATAATAGTAAGAGAAGAAGAACTCAGTCTCTTTGGTTCCTTTTGAGAAAGCACATGTTCTACCTGGAAGCTCAACTGCCGTCCTCCAGCATGG

TAGATCTACCCCGAGCTTCATCTCGGACTGGGAGGAAAACCAAAATACTGGAAACACCTGCCTGTCTTATGGCCTGTTAGGGCCCTCACTGCACTATTTG

GATGGTAGCCACTTTGCCTGACTGAATCAAGATTCCCTAGCTAGCCCTTATTATTTGTTTTTGACAGATGAATAGTCACTTATAGGAGATGGAGCAACCG

TGTGACCTGCTTCAGATCAGAATAAAAGGCTCAAAGAGTTTGACTTGGTGGCCAATATCTGCCTTCCAAAGAGATCTACGTCTTGCAGAAGTTGCCCTCT

TCCTAACCCACACTCCTTCATTTGACAAGTACTTACTGAGTATTTAACCGAGTACCAGTCACTACGTTTTTAAAAAAGACAAGACTTGGTCCTTAAGTTC

AAGGTCTAGGAGGCAATGTTAATCTCCTTTAAGTAACCATCCCTTTATTATCTGGACCTTGAAAATCATCTGAGAGATGCAGGTGAAGGCCAAGGAGTCA

ATTAAAAGAAGCCTTTGGTTAGATCTCCAATATGTTGTAGGCAGAAGGTTGGGGATCAGTTTAAATGAAGCCTGAAGAACTGTGGAATCTTGCTTGTCTT

GAGTGGGAAAATCTACTTCTGTCATTTCTGGAAACCAGTGGAACCAAATTCCAGGTTGAGCTGCCTCATGGGCTAATGTGTTAGCGCTCTGCAGTGCAGG

GATATATACTATACGTCTGGACCTGAGAATACGCTCTTCAGGTTCCTTAGTAGCACACGACGTACCAGAATCTATACCAAGATTCTTTAGGCAAACTAAC

CTGGGCCATTGTTCCACCCAACCAAGGAATTACGTGCCCCTGACTCTTAATAGTCTATTTTCATTTAGATCCTCAAGAAGGTCTAGCTTGTCCCTTTTGT

ACCCATCCACCCCCGGCAAAAGCTTCTATATTCACCTGGTAGCCCCAGGGATGACAGGGTCCTCTATTCTGGAGACTGTTATTGCTACTGCTGCTAATTC

CACGAGCTGTGAAGATCCCCAACTCAGCTGCAAAATATGCAATTCTGTGGTGGGAAGAGGCTGACTGTCCGAGGATGGTGCTGAAATCACTGCCTTAAGG

TCTTTGCTGTGCAGAATGAGAAGGCCCCCCCAGAGCTGGGTGTTCCAACTTAGAAGGAAGGGAAGACTGGATAGGCCTACTTTGGACATAGGTCTCTTCT

GAACCCTATCCAAAGCTCCAGTACATGGCAAGGCTCAGACTTTTGCTAACATCCTAACGCTTGAGCCTTTCACCCTCTTTTTCTGGTGCTGCCCAGCCAG

TGCCTTCTGACACGGATGTTACTGGCTACTTAAGAAGAAGGAAAGTAGGAAATGCCTTCTTCCATTCCAACTGCCTCAGACTACAGAGAGAGTGTCTCTG

TGGTAACTATGGATACCATCGAGAATTTTATTTGGGTCTGCAGCAAGTTGATTCTGGAGGCCTCGCATACTTTGACTTCATTTCTATTCCTGGGATCCAC

CACCCTCTTCTCTCAGTTGACTGCTGCATTTAGTTCAGGCCTCAAATAGCTGTCCTCCAGGAAGTGCGTTCCCATCTAGTGAAGTGCTCTCGAAGCCTAC

ACTTTCCTTCTGGAGCCTGGGACCCTGTTTACAGTTGCACATCTGGGC
Translation
MLGSSVKSVQPEVELSGGSGSGGDEGADESRGASRKAAAADGRGMLPKRAKAAGGSGSMAKASAAELKVFKSGSVDSRVPGGLPTSNLRKQKSLTNLSFL

TDSEKKLQLYEPEWSDDMAKAPKGLGKLGPKGRETPLMSKTLSKSEHSLFQPKGGSTGGAKTPLAPLAPSLGKPSRIPRGPYAEVKPLSKAPEAAVSDDG

KSDDELLSSKAKAQKGSGTVPSAKGQEERAFLKVDPELVVTVLGDLEQLLFSQMLD - UNI24202 - DPESQRKRTVQNVLDLRQNLEETMSSLRGS

QVTHS - UNI15035 - SSLEMPCYDSDDANPRSVSSLSNRSSPLSWRYGQSSPRLQAGDAPSVGGSCRSEGPPAWYMHGERAHYSHTMPMRSPSKLS

HISRLELVESLDSDEVDLKSGYMSDSDLMGKTMTEDDDITTG - UNI15035 - GWDESSSISSGLSDASDNLSSEEFNASSSLNSLPTTPTASRRSS

TIV - UNI15035 - LRTDSEKRSLAESGLNWFSESEEKTPKKLEYDSGSLKMEPGTSKWRRERPESCDDASKGGELKKPISLGHPGSLKKGKTPPVA

VTSPITHTAQSALKVAG GKPEGKATDKGKLAVKNTGLQRSSSDAGRDRLSDAKKPPSGIARPSTSGSFGYKKPPPATGTATVMQTGSSATLSKIQKSSG

IPVKPVNGRKTSLDVSNSVEPGFLAPGARSNIQYRSLPRPAKSSSMSVTGRGGPRPVSSSIDPSLLSTKQGGLTPSRLKEPSKVASGRSTPAPVNQTDRE

KEKAKAKAVALDSDNISLKSIGSPESTPKNQASHPPATKLAELPPTPLR RATAKSFVKPPSLANLDKVNSNSLDLPSSSDTHASKVPDLHAPSSSTGGP

LPSCFTPSPAPILNINSASFSQGLELMSGFSVPKETRMYPKLSGLHRSMESLQMPMSLPSAFPSSAPIPTPPTAPSEEDTEELPWSGSPRAGQLDS SSQ

RDRNTLPKKGLR - UNI15235 - RYQLQSQEETKERRHSHTAGGLPESDDQAELPSPPALSMSLSAKGQLTNIV - UNI15235 - VSPTAATTP

RITRSNSIPTHEAAFELYSGSQMGSTLSLAERPKGMIRSGSFRDPTDDV - UNI15235 - VHGSVLSLASSASSTYSS AEERMQSE QIRKLRREL

ESSQEKVATLTSQLSAN ANLVAAFEQSLVNMTSRLRHLAETAEEK DTELLDLRETIDFLKKKNSEAQAVIQGALNASEATPKE ELRIKRQNSSDSIS

SLNSITSHSSIGSSKDADAKKKKKKSW VYE LRSSFNKAFSIKKGPKSASSYSDIEEIATPDSSAPSSPKLQHGSTETASPSIKSSTSSSVGTEVTE E

TPAHSVPHTRLFQANEEEEPEKKEVSELRSELWEKEMKLTDIRLEALNSAHQLDQLRETMHNMQ LEVDLLKAENDRLKVAPGPSSGCTPGQVPGSSALS

SPRRSLGLALSHPFSPSLTDTD DLSPMDGISTCGSKEEVTLRVVVRMPPQHIIKG DLKQQEFFLGCSKVSGKVDWKMLDEAVFQVFK DYISKMDPAS

TLGLSTESIHGYSLSHVKRVLDAEPPEMPPCRRGVNNISVALKG GLKEKCVDSLVFETLIPKPMMQHYISLLLKHRRLVLSGPSGTGKTYLTNRLAEYL

VERSGREVTDGIVSTFNMHQQSCK DLQLYLSNLANQIDRETGIGDVPLVILLDDLSEAGSISELVNGALTCKYHKC CPYIIGTTNQPVKMTPNHGLHL

SFR RMLTFSNNVEPANGFLVRYLRRKLVESDSDVNANKEELLRVLDWVPKLWYHLHTFLEKHSTSDFLIG GPCFFLSCPIGIEDFRTWFIDLWNNSII

PYLQEGAKDGIK VHGQKAAWEDPVEWVRDTLPWPSAQQDQSKLYHLPPPSVGPHSTASPPEDRTVKDSTPNSLDSDPL MAMLLKLQEAANYIESPDRE

TILDPNLQATL
Transcript ENSMUST00000067414
Sequence
TCGGGGACTTCCTCTCCAGTGTGCAGCCCCGTGCAGAGCATGCGGTCCTCAGCTACTCCTGGAGTCATTAGCTTTTCCTCAGCCCATCCGCAGAGTCAAC

CAATCACAGCCACAGTAGCCCCCTTCCAGTACAG ATTACAGACAGACCAGGAACCTGGTCCTGTGCCTCAGGAAAGCTGGGTCCTTGATGGATACACCA

GCCCCCCTAGCAGGACTGAGGACAGCTTTTCCTGCATGG ACGCGCGGATCGTCCATGCGCTCCTCGCAGGCAGAATGCTGGGCAGCAGCGTCAAGAGCG

TGCAGCCCGAGGTGGAGCTGAGCGGCGGCAGCGGCAGCGGCGGCGACGAGGGCGCGGACGAGTCTCGGGGAGCCAGCAGAAAGGCAGCCGCGGCGGACGG

CAGAGGCATGCTGCCCAAGCGCGCCAAGGCGGCAGGAGGCAGTGGCAGTATGGCCAAGGCCAGTGCAGCGGAGCTGAAGGTCTTCAAGTCCGGCAGCGTG

GACAGTCGTGTCCCCGGCGGGCTGCCTACCTCCAACCTGCGCAAACAGAAGTCGCTCACCAACCTCTCGTTTCTCACGGACTCCGAGAAAAAGCTGCAGC

TGTATGAGCCTGAGTGGAGTGATGATATGGCCAAAGCACCCAAGGGTTTGGGCAAACTGGGGCCCAAGGGCCGCGAGACTCCTCTGATGTCCAAGACGCT

GTCCAAGTCTGAGCATTCGCTCTTCCAACCCAAAGGTGGCTCAACCGGCGGCGCCAAGACCCCACTGGCTCCGCTAGCGCCCAGCCTAGGCAAACCTAGC

CGGATTCCTCGGGGACCCTATGCGGAGGTCAAGCCTCTCAGCAAGGCGCCTGAGGCAGCGGTAAGCGATGATGGCAAATCGGATGACGAACTGCTTTCCA

GCAAGGCTAAAGCGCAAAAGGGCTCAGGGACTGTGCCCTCTGCCAAGGGCCAGGAGGAGCGGGCCTTCCTCAAGGTGGACCCCGAGCTTGTGGTTACCGT

GCTGGGCGACCTAGAACAGCTACTCTTCAGCCAGATGCTAG - UNI24202 - ATCCAGAGTCGCAGAGAAAGAGAACAGTACAGAACGTTCTGGATC

TCCGACAGAACCTGGAAGAAACCATGTCCAGCCTGCGAGGCTCCCAGGTGACTCACAG - UNI15035 - CTCCCTGGAGATGCCTTGTTACGACAGC

GATGACGCCAACCCCCGAAGCGTGTCCAGTCTCTCCAACCGCTCCTCTCCGCTCTCTTGGCGCTACGGCCAGTCTAGTCCCCGGCTGCAGGCTGGCGACG

CACCCTCTGTTGGGGGGAGCTGTCGTTCCGAGGGGCCACCGGCCTGGTACATGCATGGCGAGCGGGCACACTACTCCCACACCATGCCGATGCGGAGCCC

CAGCAAACTCAGCCACATCTCTCGCCTGGAGTTGGTGGAGTCCCTGGACTCTGACGAGGTGGACCTCAAATCCGGCTACATGAGTGACAGTGACCTCATG

GGCAAGACCATGACAGAAGACGATGACATCACAACGGG - UNI15035 - CTGGGATGAAAGCAGCTCCATTAGCAGTGGGCTCAGCGATGCCTCCGA

CAACCTCAGCTCAGAAGAGTTCAATGCCAGCTCCTCACTCAACTCCCTCCCAACCACTCCCACTGCCTCCCGCAGGAGCTCCACTATAGTG - UNI150

35 - TTACGCACAGACTCGGAGAAGCGCTCCCTGGCGGAGAGTGGGCTCAACTGGTTCAGTGAGTCAGAGGAGAAGACCCCTAAAAAACTGGAGTACGA

CAGTGGTAGCCTGAAGATGGAACCTGGGACTTCAAAGTGGCGGAGAGAGAGACCAGAGAGCTGCGATGACGCATCCAAGGGCGGAGAACTGAAAAAGCCC

ATCAGCCTGGGACACCCAGGGTCCTTGAAAAAGGGCAAGACCCCTCCGGTGGCTGTCACCTCTCCCATCACTCACACCGCCCAGAGTGCCCTCAAAGTCG

CAG GCAAACCTGAAGGCAAAGCTACAGACAAGGGTAAACTCGCAGTGAAGAACACTGGGCTACAACGCTCCTCTTCTGATGCTGGCCGGGACCGCCTGA

GTGATGCTAAGAAGCCCCCCTCAGGCATTGCTCGGCCCTCTACTTCAGGATCCTTTGGTTATAAGAAGCCTCCCCCTGCTACTGGCACAGCCACTGTCAT

GCAGACCGGTAGCTCAGCCACCCTCAGCAAGATCCAGAAGTCCTCAGGGATCCCTGTGAAGCCAGTAAACGGGCGCAAGACGAGTTTAGACGTGTCCAAC

AGTGTAGAGCCCGGATTTCTCGCCCCTGGAGCACGGTCCAACATCCAGTATCGCAGCCTACCCAGGCCAGCCAAGTCCAGTTCTATGAGTGTGACTGGGC

GTGGTGGACCTCGGCCTGTTAGCAGCAGCATTGACCCCAGCCTCCTCAGCACCAAGCAGGGTGGCCTTACACCCTCCAGACTGAAGGAACCTTCCAAGGT

CGCCAGTGGTCGGAGCACTCCAGCCCCTGTCAATCAGACAGATCGGGAAAAGGAGAAGGCCAAAGCCAAGGCTGTGGCCCTGGACTCAGACAACATCTCC

TTGAAGAGCATAGGCTCCCCAGAAAGCACTCCCAAGAACCAAGCAAGCCACCCTCCAGCCACCAAGTTAGCAGAGCTGCCACCAACCCCTCTCAG GGCC

ACAGCTAAAAGCTTTGTCAAGCCACCCTCGCTAGCCAATCTAGACAAAGTCAACTCCAACAGTTTGGATCTACCATCTTCCAGCGACACCCATGCTTCCA

AGGTCCCAGATCTGCATGCTCCGAGCTCATCAACTGGGGGCCCTCTCCCTTCTTGCTTCACTCCCAGCCCAGCACCCATCCTCAATATTAACTCAGCCAG

CTTCTCCCAGGGCCTGGAGCTAATGAGTGGTTTCAGTGTCCCAAAGGAGACCCGCATGTACCCCAAACTCTCAGGCCTGCACAGGAGCATGGAGTCCCTC

CAGATGCCAATGAGCCTGCCCAGTGCCTTCCCCAGCAGCGCCCCCATCCCTACCCCACCTACTGCCCCATCAGAGGAAGACACAGAAGAGCTGCCCTGGA

GTGGAAGCCCCAGGGCTGGACAATTGGACAG CAGTCAGCGAGATCGGAATACCCTCCCCAAGAAAGGGCTCAG - UNI15235 - GTACCAGCTTCA

GTCCCAGGAGGAGACCAAGGAGAGGCGGCACTCCCACACTGCCGGTGGGCTTCCAGAATCCGACGACCAGGCAGAGCTGCCATCCCCCCCTGCTCTCTCC

ATGTCCTTGAGTGCAAAGGGCCAGCTTACCAACATAG - UNI15235 - TTCATGGCTCGGTGCTGTCTCTGGCCTCCAGTGCTTCTTCTACCTACTC

CTCA GCTGAGGAGAGGATGCAATCTGAG CAAATTCGGAAGCTTCGTAGGGAGCTGGAGTCGTCCCAGGAAAAGGTGGCCACCCTGACATCTCAGCTGT

CTGCCAAC GCTAACCTAGTGGCCGCTTTCGAGCAGAGCCTGGTGAATATGACATCCCGCCTGCGACACCTGGCAGAGACGGCCGAGGAGAAG GACACC

GAGCTGTTGGATTTGCGAGAAACTATAGACTTCCTGAAGAAAAAGAATTCCGAGGCCCAGGCAGTCATCCAGGGAGCGTTAAATGCCTCAGAAGCCACGC

CCAAAG AACTCCGGATCAAGAGGCAGAATTCCTCAGATAGCATCTCCAGCCTCAACAGCATCACCAGCCATTCCAGCATCGGCAGCAGCAAAGATGCTG

ATGCCAAGAAGAAAAAGAAGAAGAGTTGG CTTCGGAGTTCCTTCAACAAAGCCTTCAGTATTAAAAAGGGTCCCAAGTCAGCCTCCTCCTACTCTGACA

TTGAAGAGATTGCCACACCTGACTCCTCAGCCCCATCATCCCCCAAACTCCAACACGGCTCCACTGAGACTGCCTCCCCCTCCATCAAGTCCTCCACCTC

ATCCTCTGTGGGCACCGAGGTCACCGA GACCCCTGCTCATTCAGTCCCCCACACTAGACTGTTCCAAGCCAATGAAGAGGAGGAGCCAGAGAAGAAGGA

GGTATCAGAACTGCGCTCTGAACTATGGGAAAAAGAGATGAAGCTCACGGATATCCGGTTGGAGGCCCTCAACTCTGCCCACCAGCTGGACCAGCTTCGG

GAGACCATGCACAATATGCAG TTGGAGGTGGACCTGCTGAAAGCAGAGAATGACCGGCTGAAGGTTGCCCCCGGCCCCTCCTCAGGCTGCACTCCAGGG

CAGGTCCCTGGGTCATCGGCTCTGTCGTCCCCTCGACGTTCCCTGGGCCTTGCACTCAGCCATCCTTTCAGTCCTAGTCTCACAGACACAG ACCTCTCA

CCCATGGATGGCATCAGCACCTGTGGTTCAAAGGAAGAGGTGACCCTGCGGGTGGTGGTCCGGATGCCGCCCCAGCACATCATCAAAGGG GACTTAAAG

CAGCAGGAGTTCTTCCTGGGTTGCAGCAAGGTCAGTGGCAAAGTTGACTGGAAGATGCTGGATGAAGCCGTTTTCCAAGTGTTCAAG GACTACATTTCT

AAAATGGACCCAGCCTCAACCCTGGGACTGAGCACTGAGTCCATACATGGCTATAGCCTCAGCCACGTGAAACGAGTGCTGGATGCTGAGCCCCCAGAGA

TGCCTCCTTGCCGCCGAGGTGTCAATAACATATCAGTCGCTCTCAAAG GTCTGAAAGAGAAGTGTGTCGACAGCCTGGTGTTCGAGACGCTTATCCCCA

AGCCCATGATGCAGCACTACATCAGCCTCCTGCTCAAGCACCGGCGCCTGGTGCTCTCCGGCCCCAGTGGCACCGGCAAGACCTACTTGACCAATCGGCT

AGCCGAGTACCTGGTGGAGCGCTCCGGCCGCGAGGTCACGGATGGCATCGTCAGCACTTTCAACATGCACCAGCAGTCTTGCAAG GATCTGCAACTGTA

CCTCTCCAACCTAGCCAACCAGATAGACCGGGAAACAGGGATAGGGGATGTGCCCTTGGTGATCCTCCTGGATGATCTGAGTGAAGCAGGCTCCATCAGT

GAGCTGGTCAATGGGGCCCTCACCTGCAAGTATCACAAATG TCCCTACATTATAGGTACCACCAATCAGCCTGTAAAAATGACACCCAACCATGGCTTG

CACTTGAGCTTCAG GATGCTGACCTTCTCGAACAATGTGGAACCAGCCAATGGCTTTCTGGTCCGTTACCTGCGGAGGAAGTTGGTAGAGTCAGACAGT

GACGTCAATGCTAACAAGGAAGAGCTGCTTCGGGTGCTGGACTGGGTGCCCAAGCTGTGGTATCACCTCCACACCTTCCTGGAGAAGCACAGCACCTCGG

ACTTCCTCATTG GCCCTTGCTTCTTCCTGTCCTGTCCCATTGGCATCGAGGACTTCCGGACCTGGTTCATTGACCTGTGGAACAATTCCATCATCCCCT

ATCTACAGGAAGGAGCCAAGGATGGGATCAAG GTTCATGGACAGAAAGCTGCTTGGGAAGACCCGGTGGAATGGGTCCGAGACACTCTTCCCTGGCCGT

CGGCCCAACAAGACCAATCAAAGCTCTACCACCTGCCCCCGCCTTCTGTGGGCCCCCACAGCACTGCCTCACCCCCGGAGGACAGGACAGTCAAAGACAG

CACTCCAAACTCCCTCGACTCAGATCCCCTG ATGGCCATGCTACTGAAACTCCAAGAAGCTGCCAACTACATTGAGTCACCAGATCGAGAGACTATCCT

GGACCCCAACCTCCAGGCGACACTCTGA
Translation
SGTSSPVCSPVQSMRSSATPGVISFSSAHPQSQPITATVAPFQYR RLQTDQEPGPVPQESWVLDGYTSPPSRTEDSFSCMD DARIVHALLAGRMLGSS

VKSVQPEVELSGGSGSGGDEGADESRGASRKAAAADGRGMLPKRAKAAGGSGSMAKASAAELKVFKSGSVDSRVPGGLPTSNLRKQKSLTNLSFLTDSEK

KLQLYEPEWSDDMAKAPKGLGKLGPKGRETPLMSKTLSKSEHSLFQPKGGSTGGAKTPLAPLAPSLGKPSRIPRGPYAEVKPLSKAPEAAVSDDGKSDDE

LLSSKAKAQKGSGTVPSAKGQEERAFLKVDPELVVTVLGDLEQLLFSQMLD - UNI24202 - DPESQRKRTVQNVLDLRQNLEETMSSLRGSQVTHS

 - UNI15035 - SSLEMPCYDSDDANPRSVSSLSNRSSPLSWRYGQSSPRLQAGDAPSVGGSCRSEGPPAWYMHGERAHYSHTMPMRSPSKLSHISRL

ELVESLDSDEVDLKSGYMSDSDLMGKTMTEDDDITTG - UNI15035 - GWDESSSISSGLSDASDNLSSEEFNASSSLNSLPTTPTASRRSSTIV -

 UNI15035 - LRTDSEKRSLAESGLNWFSESEEKTPKKLEYDSGSLKMEPGTSKWRRERPESCDDASKGGELKKPISLGHPGSLKKGKTPPVAVTSPI

THTAQSALKVAG GKPEGKATDKGKLAVKNTGLQRSSSDAGRDRLSDAKKPPSGIARPSTSGSFGYKKPPPATGTATVMQTGSSATLSKIQKSSGIPVKP

VNGRKTSLDVSNSVEPGFLAPGARSNIQYRSLPRPAKSSSMSVTGRGGPRPVSSSIDPSLLSTKQGGLTPSRLKEPSKVASGRSTPAPVNQTDREKEKAK

AKAVALDSDNISLKSIGSPESTPKNQASHPPATKLAELPPTPLR RATAKSFVKPPSLANLDKVNSNSLDLPSSSDTHASKVPDLHAPSSSTGGPLPSCF

TPSPAPILNINSASFSQGLELMSGFSVPKETRMYPKLSGLHRSMESLQMPMSLPSAFPSSAPIPTPPTAPSEEDTEELPWSGSPRAGQLDS SSQRDRNT

LPKKGLR - UNI15235 - RYQLQSQEETKERRHSHTAGGLPESDDQAELPSPPALSMSLSAKGQLTNIV - UNI15235 - VHGSVLSLASSASS

TYSS AEERMQSE QIRKLRRELESSQEKVATLTSQLSAN ANLVAAFEQSLVNMTSRLRHLAETAEEK DTELLDLRETIDFLKKKNSEAQAVIQGALN

ASEATPKE ELRIKRQNSSDSISSLNSITSHSSIGSSKDADAKKKKKKSW LRSSFNKAFSIKKGPKSASSYSDIEEIATPDSSAPSSPKLQHGSTETAS

PSIKSSTSSSVGTEVTE ETPAHSVPHTRLFQANEEEEPEKKEVSELRSELWEKEMKLTDIRLEALNSAHQLDQLRETMHNMQ LEVDLLKAENDRLKVA

PGPSSGCTPGQVPGSSALSSPRRSLGLALSHPFSPSLTDTD DLSPMDGISTCGSKEEVTLRVVVRMPPQHIIKG DLKQQEFFLGCSKVSGKVDWKMLD

EAVFQVFK DYISKMDPASTLGLSTESIHGYSLSHVKRVLDAEPPEMPPCRRGVNNISVALKG GLKEKCVDSLVFETLIPKPMMQHYISLLLKHRRLVL

SGPSGTGKTYLTNRLAEYLVERSGREVTDGIVSTFNMHQQSCK DLQLYLSNLANQIDRETGIGDVPLVILLDDLSEAGSISELVNGALTCKYHKC CPY

IIGTTNQPVKMTPNHGLHLSFR RMLTFSNNVEPANGFLVRYLRRKLVESDSDVNANKEELLRVLDWVPKLWYHLHTFLEKHSTSDFLIG GPCFFLSCP

IGIEDFRTWFIDLWNNSIIPYLQEGAKDGIK VHGQKAAWEDPVEWVRDTLPWPSAQQDQSKLYHLPPPSVGPHSTASPPEDRTVKDSTPNSLDSDPL M

AMLLKLQEAANYIESPDRETILDPNLQATL

For any suggestions or comments, please send an email to unitrap@crg.es