Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000009555 (Cdk9)
Chromosomal location
Chr 2: 32562964 - 32568275 (-)
Description
cyclin-dependent kinase 9 (CDC2-related kinase) Gene [Source:MGI (curated);Acc:Cdk9-001]
RefSeq_dna
NM_130860 
RefSeq_peptide
NP_570930.1 
UniGene
Mm.27557 
MGI
MGI:1328368 
Uniprot/SWISSPROT
Q99J95 
Uniprot/SPTREMBL
B0R020 B0R021 A2AK82 
Human Ortholog
ENSG00000136807 (CDK9)
Omim not available
UniTrap UNI17797
Vector Insertion
Chr 2: 32563810 - 32564986
Public Clones not available
Private Clones OST436294 (lexicon)
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37248
Vector Insertion
Chr 2: 32563304 - 32563810
Public Clones CMHD-GT_473E6-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000120105
Sequence
GGAAGACACGCGGTGTGGAATGACCGCGTCCCGGATCCGAGGCCGCACCCCGCCCGCC GGAAGTCTTTAAAGCCAAGCACCGTCAGACGGGCCAGAAGG

TGGCTCTGAAGAAAGTGTTGATGGAGAATGAGAAGGAGGGG TTCCCCATCACAGCCTTGAGGGAAATCAAGATTCTACAGCTCCTAAAACATGAGAATG

TGGTGAACCTAATTGAGATTTGTCGGACCAAAG CCTCACCGTATAACCGCTGCAAGGGCAGCATCTATCTGGTGTTTGACTTCTGTGAGCATGACCTTG

CTGGGCTGCTGAGCAACGTCTTAGTCAAGTTCACGTTGTCTGAGATCAAGAGAGTGATGCAGATGCTGCTGAACGGCCTCTACTACATCCACAGGAACAA

G ATCCTGCACAGGGACATGAAGGCTGCGAATGTGCTCATTACCCGGGATGGGGTCCTGAAGCTGGCAGATTTTGGGCTGGCCCGTGCCTTCAGCCTAGC

TAAGAATAGCCAGCCCAACCGATACACCAACCGTGTGGTGACATTGTGGTACCGGCCTCCGGAGCTGCTGCTCG GAGAGCGGGACTACGGCCCGCCCAT

TGACCTTTGGGGTGCTGGGTGCATCATGGCAGAGATGTGGACTCGTAGCCCTATCATGCAGGGTAACACAGAGCAGCACCAGCTCGCCCTCATCAGCCAG

CTCTGTGGCTCCATCACCCCAGAG - UNI17797 - GTGTGGCCAAACGTAGACAAGTATGAGCTGTTTGAAAAGCTGGAACTTGTGAAGGGCCAGAA

GCGGAAGGTGAAGGACCGTCTGAAGGCCTACGTGCGCGACCCCTATGCTCTGGACCTCATTGACAAGCTGCTGGTGCTGGACCCCGCGCAGCGGATTGAC

AGTGACGATGCCCTCAACCACGACTTCTTCTGGTCGGACCCCATGCCCTCGGACCTCAAGGGCATGCTGTCTACTCACTTGACGTCTATGTTTGAGTACC

TGGCACCGCCACGGCGGAAGGGCAGCCAGATCACCCAGCAGTCCACCAACCAGAGCAGAAATCCCGCCACCACCAACCAGACGGAATTTGAACGTGTCTT

CTGAGGCCGGAACTGGCCGGTGTTGTTCTTAGGTTAGGAGTGGATTGCTTCCTTTGCATGGAACATGTGACATGATGGGACATTTGAGATTTTCTCCTCC

AGTACATATTAACTCCCACCCTGGCACTGGGAACAGCTGCCTGAGTGGGCTGGGGTGGAGCTATCCTGCCTGCCCCTCTCTGGAGGTCTCAGCGTGGACA

CAAAGTGAGGTGGGAGAGGCTCACCCACTGTGACTTTCTAAGAACTACTTGCATGGTGGGAGGAAGGCACAGGTCCCTCGCCATCGCCAGCTCTTCCTCT

GGATGAGAGTTTGAGGGACAGAGGCGCCTCCAAAATGGGCTACTTTTGGTCTGGACCTTAGGGGCGTGGGGCTGTGTGAACTCCTGGTTCCTTTAAAAGG

AGAATTTTATTTTGTTTTGTTAAGTTTAGAGACATTCCTGGACGCAGTTTGATTGGTTAAATTAAAAGTTGGTTATTTTTTTCC
Translation
 MENEKEG FPITALREIKILQLLKHENVVNLIEICRTKA ASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNK IL

HRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLG GERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQL

CGSITPE - UNI17797 - VWPNVDKYELFEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLST

HLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF
Transcript ENSMUST00000009699
Sequence
GGCCGCGGAGGGGCCTGGAGTGTGGCGGGACCGGGAGCGGCGGGAGCTGCGGCTGGGGGCGGCGGCGGCGGCGGCGGCGGAGGCGCGCTGGAGGTGGCCA

TGGCCAAGCAGTACGACTCGGTGGAATGCCCGTTCTGCGATGAGGTCACCAAGTACGAGAAACTTGCCAAGATCGGCCAAGGCACATTCGG GGAAGTCT

TTAAAGCCAAGCACCGTCAGACGGGCCAGAAGGTGGCTCTGAAGAAAGTGTTGATGGAGAATGAGAAGGAGGGG TTCCCCATCACAGCCTTGAGGGAAA

TCAAGATTCTACAGCTCCTAAAACATGAGAATGTGGTGAACCTAATTGAGATTTGTCGGACCAAAG CCTCACCGTATAACCGCTGCAAGGGCAGCATCT

ATCTGGTGTTTGACTTCTGTGAGCATGACCTTGCTGGGCTGCTGAGCAACGTCTTAGTCAAGTTCACGTTGTCTGAGATCAAGAGAGTGATGCAGATGCT

GCTGAACGGCCTCTACTACATCCACAGGAACAAG ATCCTGCACAGGGACATGAAGGCTGCGAATGTGCTCATTACCCGGGATGGGGTCCTGAAGCTGGC

AGATTTTGGGCTGGCCCGTGCCTTCAGCCTAGCTAAGAATAGCCAGCCCAACCGATACACCAACCGTGTGGTGACATTGTGGTACCGGCCTCCGGAGCTG

CTGCTCG GAGAGCGGGACTACGGCCCGCCCATTGACCTTTGGGGTGCTGGGTGCATCATGGCAGAGATGTGGACTCGTAGCCCTATCATGCAGGGTAAC

ACAGAGCAGCACCAGCTCGCCCTCATCAGCCAGCTCTGTGGCTCCATCACCCCAGAG - UNI17797 - GTGTGGCCAAACGTAGACAAGTATGAGCT

GTTTGAAAAGCTGGAACTTGTGAAGGGCCAGAAGCGGAAGGTGAAGGACCGTCTGAAGGCCTACGTGCGCGACCCCTATGCTCTGGACCTCATTGACAAG

CTGCTGGTGCTGGACCCCGCGCAGCGGATTGACAGTGACGATGCCCTCAACCACGACTTCTTCTGGTCGGACCCCATGCCCTCGGACCTCAAGGGCATGC

TGTCTACTCACTTGACGTCTATGTTTGAGTACCTGGCACCGCCACGGCGGAAGGGCAGCCAGATCACCCAGCAGTCCACCAACCAGAGCAGAAATCCCGC

CACCACCAACCAGACGGAATTTGAACGTGTCTTCTGAGGCCGGAACTGGCCGGTGTTGTTCTTAGGTTAGGAGTGGATTGCTTCCTTTGCATGGAACATG

TGACATGATGGGACATTTGAGATTTTCTCCTCCAGTACATATTAACTCCCACCCTGGCACTGGGAACAGCTGCCTG
Translation
MAKQYDSVECPFCDEVTKYEKLAKIGQGTFG GEVFKAKHRQTGQKVALKKVLMENEKEG FPITALREIKILQLLKHENVVNLIEICRTKA ASPYNRC

KGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNK ILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWY

RPPELLLG GERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPE - UNI17797 - VWPNVDKYELFEKLELVKGQKRKVKDR

LKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF

For any suggestions or comments, please send an email to unitrap@crg.es