Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000009630 (Ppp2cb)
Chromosomal location
Chr 8: 34710097 - 34730266 (+)
Description
protein phosphatase 2 (formerly 2A), catalytic subunit, beta isoform Gene [Source:MGI Symbol;Acc:MGI:1321161]
RefSeq_dna
NM_017374 
RefSeq_peptide
NP_059070.1 
UniGene
Mm.288765 
MGI
MGI:1321161 
Uniprot/SWISSPROT
P62715 
Uniprot/SPTREMBL
Q8BN07 
Human Ortholog
ENSG00000104695 (PPP2CB)
Omim not available
UniTrap UNI21327
Vector Insertion
Chr 8: 34710491 - 34721126
Public Clones (sanger) 5SE167E02 (ggtc) IST14797A5 (tigm)
Private Clones OST334216 (lexicon) OST332585 (lexicon) OST330183 (lexicon) OST242397 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25301
Vector Insertion
Chr 8: 34721337 - 34722219
Public Clones not available
Private Clones OST188459 (lexicon)
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11752
Vector Insertion
Chr 8: 34726300 - 34727498
Public Clones P017D05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000009774
Sequence
GAGCGAGAGGGCCGTGGCCAGAGCGCGGAGAGGCCTGCGGGTGGCAGCGGGCGGGCGGGCGCCGTCGGGCCGGAGCCGAGCCGAGCTGCGCCGCGCTCTG

CGCTCCGAGCCGTAAGCCCTTCGCCGCGCCCCAGGCGCGTGGCCGGGGCCGGGCGGGGCGGGCGCTCCCGGAGGCCGGGGCCCGCGGCTGCCCGCTGGGC

TTGGGCGGGGCGCGGGCTGCGCGCTCCGCGGCTCGGTGGTCCCGCCGGGGGCCGGCGGCGGGGGAGGCGGCGGGGACGCGCGGCTCGCCGCCATGGACGA

CAAGGCGTTCACCAAGGAGCTGGACCAGTGGGTGGAGCAGCTGAACGAGTGTAAGCAGCTGAACGAGAACCAAGTGCGGACGCTGTGCGAGAAG - UNI

21327 - GCTAAGGAAATTTTAACGAAAGAATCAAATGTGCAAGAGGTCCGCTGTCCTGTTACCGTCTGTGGAGATGTGCATGGCCAATTCCATGACCT

TATGGAGCTCTTCAGAATTGGTGGGAAATCACCAGATACGAACTACCTATTCATGGGGGACTATGTAGACAGAGGGTACTACTCTGTGGAGACTGTGACT

CTTCTTGTAGCATTAAAG - UNI25301 - GTGCGCTATCCAGAGCGCATCACAATATTGCGAGGAAATCACGAAAGCCGGCAGATCACACAAGTGTA

TGGCTTTTATGATGAGTGCCTACGGAAGTATGGAAATGCCAACGTGTGGAAATACTTTACAGATCTCTTTGATTATCTTCCACTTACAGCTTTAGTAGAT

GGACAG ATATTCTGCCTCCACGGTGGCCTGTCTCCATCCATAGATACACTGGACCACATAAGAGCCCTGGATCGCTTGCAAGAAGTTCCACATGAG GG

CCCAATGTGTGATCTCTTATGGTCAGATCCGGATGACCGTGGCGGCTGGGGCATTTCTCCACGTGGTGCTGGCTACACATTTGGACAAGACATTTCTGAA

ACATTTAACCATGCCAACGGTCTCACACTGGTGTCTCGTGCTCACCAGCTTGTAATGGAA - UNI11752 - GGATATAACTGGTGCCATGATCGGAA

TGTGGTCACCATTTTTAGTGCGCCCAATTACTGCTACCGTTGTGGGAACCAGGCTGCTATCATGGAATTAGATGACACTTTAAAATATTCATT TCTTCA

GTTTGACCCAGCACCTCGTCGTGGAGAGCCTCATGTGACCCGGCGCACCCCAGACTACTTCCTGTAAATTCCTCCCCAGGACCTGTCTTTGTATGTGGAA

GTATACCTGGCTTTTTAAAATATATATATATACATATATATTTAAAAACAACAGTTATTTGTGTTTCTGTAACAAATTGTGATATGTCTTGACATTAAAA

CACATCATGGACCAAAACGTGCCATACTAATGATGAGCGGTTAGCACAATGTGAACTCTAGCACACTGTTGTAGATGAGTCAGCCCACAGCCTGCCTGCT

GGGCGGTAGTGACCATTTTTCTTGACTGGTTAAGCAAAAAGGGTCACTGACTGCTTCGTCTCCTTTGCGCTTACTTGGAAATTTAGTTAACAAGTTTAAC

TGGCATGGATTATAGAGTTGGAGTTTTATTTTTTAAGAATTCACAAGCTGACTTCCACTTCAATTCATAATCCTTTATTTTATTGAAATGTATGACTAAC

TGAAGAAGAGATTCTTGGGAGTATGTTGTCATAACATTAAAGAGATTTCCTTTAAAGTTTCCTAAACTAAATTACTGTTGGATGTTGAGCTGCATATTTC

TGTATATTTGTCATGACAGTGCTTGCATCCTATTTGGTGTACTGAACAAATAAAATTTCCGATTTAG
Translation
MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEK - UNI21327 - AKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDY

VDRGYYSVETVTLLVALK - UNI25301 - VRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQ IFCLHGGLS

PSIDTLDHIRALDRLQEVPHE GPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVME - UNI11752 - GYNWCHDRNV

VTIFSAPNYCYRCGNQAAIMELDDTLKYSF FLQFDPAPRRGEPHVTRRTPDYFL

For any suggestions or comments, please send an email to unitrap@crg.es