Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000009670 (Tex11)
Chromosomal location
Chr X: 98033987 - 98255006 (-)
Description
testis expressed gene 11 Gene [Source:MGI (curated);Acc:Tex11-001]
RefSeq_dna
NM_031384 
RefSeq_peptide
NP_113561.1 
UniGene
Mm.134024 
MGI
MGI:1933237 
Uniprot/SWISSPROT
Q14AT2 
Human Ortholog
ENSG00000120498 (TEX11)
Omim not available
UniTrap UNI27466
Vector Insertion
Chr X: 98181087 - 98203041
Public Clones not available
Private Clones OST59015 (lexicon)
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27853
Vector Insertion
Chr X: 98101544 - 98111864
Public Clones not available
Private Clones OST45768 (lexicon)
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27727
Vector Insertion
Chr X: 98045717 - 98047164
Public Clones not available
Private Clones OST51395 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113716
Sequence
GAGAGACGGAGACGGAGTCGGAGACGCGAGACGCCAGCAAGCGTTTCGGGTGTGGGAGAGCAGACGCCTCCCTGTTTAACAACTTTCTCCTGGATTTGCA

GCTTCCTCAACGTCCCTGCACCTTCAG GCTGGAGCCAGACATTTAAAAAATGGACCGCATTACTGACTTTTACTTCTTGGACTTCAGAG AATCTGTTA

AAACCCTGATCATAACTGGTAATTCATGGAGACTACAAGAAATGATTGACAGATTCTTCACAAACATATCAAATTTCAACAGAGAGTCTCTGACTGAAAT

ACAGAATATTCAG ATTGAAGAAATTGCAGTGAACCTGTGGAACTGGGCAGTTACTAAGAGAGTAGAACTGTCTGTGAGGAAAAACCAGGCAGCTAAAC 

TGTGTTATATTGCTTGCAAGCTGGTATATATGCATGGAATCTCAGTCTCTTCAGAAGAAGCTATTCAAAGACAGATTTTG ATGAATATAAAAACAGGAA

AAGAGTGGTTGTATACTGGAAATGCTCAGATTGCTGATGAATTTTTTCAAGCTGCCATGACT GATCTGGAGAGATTATATGTCAGATTAATGCAGAGCT

GCTACACCGAGGCCAACGTGTGTGTGTATAAGATGATTGTTGAGAAAGGCATCTTCCATGTGCTTTCTTACCAAGCTGAGTCA GCTGTTGCTCAAGGGG

ATTTCAAGAAAGCATCTATGTGCGTCTTACGTTGCAAAGATATGCTGATGAGACTCCCTAACATG ACAAAATATCTTCATGTACTCTGTTACAACCTTG

GCATAGAAGCAAGCAAGCGGAATAAATACAAAGAGAGTTCATTCTGGCTTGG - UNI27466 - CCAAAGCTATGAAATTGGGAAGATGGATAGGCGT

TCTGTTGAGCCACAAATGCTG GCTAAAACGCTGCGGTTACTAGCCACTATTTATTTGAATTGTGGTGGCGAAGCATATTATACCAAGGCCTTCATTGCT

ATACTCATTGCAAACAAG GAACATTTACATCCAGCTGGGCTTTTCTTAAAGATGAGGATCCTCATGAAAGGCAACTCATGTAATGAAGAACTCCTTGAA

G CTGCTAAGGAAATACTATATCTTGCTATGCCTTTGGAATTCTATCTGAGCATTATTCAATTCCTGATAGATAATAAAAG AGAGTCTGTTGGGTTTCG

CTTTCTGAGAATCATCTCTGACAATTTTAAGTCGCCAGAAGATAGGAAGAGAATTCTGTTGTTCTACATTGACACGCTTTTACAAAAGGATCAAGACATG

ATTGCTGAAGAGAAGATTAAAGACGTCCTTAAAG GTTACCAAACAAGAAGTCGACTGTCAAGAGATTTGGTAAATTGGTTACACAACATTCTGTGGGGA

AAGGCTTCCAGAAGTGTTAAG GTCCAAAAATATGCTGATGCCCTACACTGGTACAGTTATTCTCTGAAGTTGTATGAGTATGATAAAGCAGATCTGGAT

TTGATCAAGCTGAAGAGGAACATGGTTTCCTGTTACTTATCTTTGAAACAACTTGATAAG GCTAAAGAGGCCATAGCAGAAGTTGAGCAAAAGGATCCT

ACACATGTTTTCACTCGGTATTATATATTCAAGATCGCAATCATGGAGGGTGATGCTTTCAGAG CTTTACAGGTGGTCAGTGCTTTAAAGAAATCATTA

ATGGATGGAGAATCAGAAGATCGTGGACTAATTGAAGCTGGAGTTTCAACTCTCACAATCCTAAGTTTATCTATAGATTTTGCTCTAGAG - UNI2785

3 - AATGGACAGCAATTTGTGGCAGAAAGAGCTTTGGAATATTTATGTCAACTTTCAAAAGACCCAAAAGAAGTACTTGGAGGTTTAAA GTGTCTCAT

GCGGATTATTCTTCCACAAGCTTTTCATATGCCAGAATCTGAATATAA AAAGAAAGAAATGGGTAGACTTTGGAACTACTTGAATACAG CACTCCTGA

AATTTTCTGAATATTTTAATGAAGCTCCCTCAACTTTGGATTATATGGTTAATGATGCCAATTGGTTCAGGAAAATAG CTTGGAACTTAGCTGTGCAAT

CTGAGAAGGATCTAGAGGCAATGAAAAACTTTTTCATGGTTTCTTATAAG CTGTCCCTTTTTTGTCCTTTGGATCAAGGACTACTGATTGCACAGAAAA

CGTGTTTACTTGTAGCAGCTGCAGTTGATCTGGATAGAGGAAGAAAAGCTCCAACAATTTGTGAGCAG GTGTCCACAAAGTGCAAAAGAGGGCATCAGA

CCTTCTGGAATTACAGATGGTAG
Translation
 MDRITDFYFLDFRE ESVKTLIITGNSWRLQEMIDRFFTNISNFNRESLTEIQNIQ IEEIAVNLWNWAVTKRVELSVRKNQAAKL LCYIACKLVYMH

GISVSSEEAIQRQIL MNIKTGKEWLYTGNAQIADEFFQAAMT DLERLYVRLMQSCYTEANVCVYKMIVEKGIFHVLSYQAES AVAQGDFKKASMCVL

RCKDMLMRLPNM TKYLHVLCYNLGIEASKRNKYKESSFWLG - UNI27466 - GQSYEIGKMDRRSVEPQML AKTLRLLATIYLNCGGEAYYTKAF

IAILIANK EHLHPAGLFLKMRILMKGNSCNEELLEA AAKEILYLAMPLEFYLSIIQFLIDNKR RESVGFRFLRIISDNFKSPEDRKRILLFYIDTLL

QKDQDMIAEEKIKDVLKG GYQTRSRLSRDLVNWLHNILWGKASRSVK VQKYADALHWYSYSLKLYEYDKADLDLIKLKRNMVSCYLSLKQLDK AKEA

IAEVEQKDPTHVFTRYYIFKIAIMEGDAFRA ALQVVSALKKSLMDGESEDRGLIEAGVSTLTILSLSIDFALE - UNI27853 - NGQQFVAERALE

YLCQLSKDPKEVLGGLK KCLMRIILPQAFHMPESEYK KKKEMGRLWNYLNTA ALLKFSEYFNEAPSTLDYMVNDANWFRKIA AWNLAVQSEKDLEA

MKNFFMVSYK LSLFCPLDQGLLIAQKTCLLVAAAVDLDRGRKAPTICEQ VSTKCKRGHQTFWNYRW
Transcript ENSMUST00000113718
Sequence
CGGCCTCGGCTTCGGGCCACCAGAGACGGAGAGACGGAGACGGAGTCGGAGACGCGAGACGCCAGCAAGCGTTTCGGGTGTGGGAGAGCAGACGCCTCCC

TGTTTAACAACTTTCTCCTGGATTTGCAGCTTCCTCAACGTCCCTGCACCTTCAG GCTGGAGCCAGACATTTAAAAAATGGACCGCATTACTGACTTTT

ACTTCTTGGACTTCAGAG AATCTGTTAAAACCCTGATCATAACTGGTAATTCATGGAGACTACAAGAAATGATTGACAGATTCTTCACAAACATATCAA

ATTTCAACAGAGAGTCTCTGACTGAAATACAGAATATTCAG ATTGAAGAAATTGCAGTGAACCTGTGGAACTGGGCAGTTACTAAGAGAGTAGAACTGT

CTGTGAGGAAAAACCAGGCAGCTAAAC TGTGTTATATTGCTTGCAAGCTGGTATATATGCATGGAATCTCAGTCTCTTCAGAAGAAGCTATTCAAAGAC

AGATTTTG ATGAATATAAAAACAGGAAAAGAGTGGTTGTATACTGGAAATGCTCAGATTGCTGATGAATTTTTTCAAGCTGCCATGACT GATCTGGAG

AGATTATATGTCAGATTAATGCAGAGCTGCTACACCGAGGCCAACGTGTGTGTGTATAAGATGATTGTTGAGAAAGGCATCTTCCATGTGCTTTCTTACC

AAGCTGAGTCA GCTGTTGCTCAAGGGGATTTCAAGAAAGCATCTATGTGCGTCTTACGTTGCAAAGATATGCTGATGAGACTCCCTAACATG ACAAAA

TATCTTCATGTACTCTGTTACAACCTTGGCATAGAAGCAAGCAAGCGGAATAAATACAAAGAGAGTTCATTCTGGCTTGG - UNI27466 - CCAAAG

CTATGAAATTGGGAAGATGGATAGGCGTTCTGTTGAGCCACAAATGCTG GCTAAAACGCTGCGGTTACTAGCCACTATTTATTTGAATTGTGGTGGCGA

AGCATATTATACCAAGGCCTTCATTGCTATACTCATTGCAAACAAG GAACATTTACATCCAGCTGGGCTTTTCTTAAAGATGAGGATCCTCATGAAAGG

CAACTCATGTAATGAAGAACTCCTTGAAG CTGCTAAGGAAATACTATATCTTGCTATGCCTTTGGAATTCTATCTGAGCATTATTCAATTCCTGATAGA

TAATAAAAG AGAGTCTGTTGGGTTTCGCTTTCTGAGAATCATCTCTGACAATTTTAAGTCGCCAGAAGATAGGAAGAGAATTCTGTTGTTCTACATTGA

CACGCTTTTACAAAAGGATCAAGACATGATTGCTGAAGAGAAGATTAAAGACGTCCTTAAAG GTTACCAAACAAGAAGTCGACTGTCAAGAGATTTGGT

AAATTGGTTACACAACATTCTGTGGGGAAAGGCTTCCAGAAGTGTTAAG GTCCAAAAATATGCTGATGCCCTACACTGGTACAGTTATTCTCTGAAGTT

GTATGAGTATGATAAAGCAGATCTGGATTTGATCAAGCTGAAGAGGAACATGGTTTCCTGTTACTTATCTTTGAAACAACTTGATAAG GCTAAAGAGGC

CATAGCAGAAGTTGAGCAAAAGGATCCTACACATGTTTTCACTCGGTATTATATATTCAAGATCGCAATCATGGAGGGTGATGCTTTCAGAG CTTTACA

GGTGGTCAGTGCTTTAAAGAAATCATTAATGGATGGAGAATCAGAAGATCGTGGACTAATTGAAGCTGGAGTTTCAACTCTCACAATCCTAAGTTTATCT

ATAGATTTTGCTCTAGAG - UNI27853 - AATGGACAGCAATTTGTGGCAGAAAGAGCTTTGGAATATTTATGTCAACTTTCAAAAGACCCAAAAGA

AGTACTTGGAGGTTTAAA GTGTCTCATGCGGATTATTCTTCCACAAGCTTTTCATATGCCAGAATCTGAATATAA AAAGAAAGAAATGGGTAGACTTT

GGAACTACTTGAATACAG CACTCCTGAAATTTTCTGAATATTTTAATGAAGCTCCCTCAACTTTGGATTATATGGTTAATGATGCCAATTGGTTCAGGA

AAATAG CTTGGAACTTAGCTGTGCAATCTGAGAAGGATCTAGAGGCAATGAAAAACTTTTTCATGGTTTCTTATAAG CTGTCCCTTTTTTGTCCTTTG

GATCAAGGACTACTGATTGCACAGAAAACGTGTTTACTTGTAGCAGCTGCAGTTGATCTGGATAGAGGAAGAAAAGCTCCAACAATTTGTGAGC AGAAC

ATGTTACTAAGAACAGCACTTGAGCAGATAAAGAAATGCAAAAAAGTTTGGAATCTCCTGAAAAAAACAG GGGACTTCTCAGGTGATGACTGTGGGGTA

TTGCTTCTGCTCTATGAATTTGAAGTTAAAACCAAAACGAATGATCCATCACTGAGCAGATTTGTGGATTCAGTTTGGAAGATGCCTGATTTAGAATGCA

GAACACTTGAAACAATGGCAT - UNI27727 - TACTAGCTATGGATAAACCTGCATACTATCCTACTATTGCACATAAGGCCATGAAAAAACTTTTA

TTGATGTACAGAAAACAGGAGCCAGTTGATGTTTTAAAATACAG CGTATGCATGCACAACTTGATTAAACTTCTGGTGGCAGATGAAGTATGGAATATA

TCGCTGTATCCCCTAAAAGAAGTTCAGAGCCATTTTAAAAATACTCTGAGCATCATTCGCCAAAAC GAAGGATACCCAGAAGAGGAGATTGTATGGCTA

ATGATCAAGTCTTGGAATATTGGAATACTGATGTCTAGCAAGAACAAGTATATATCTGCAGAAAGGTGGGCTGCAATGGCATTGGATTTCCTTGGCCACC

TTAGCACCCTCAAAACAAGCTATGAAGCAAAG GTGAATCTTCTGTATGCCAACCTCATGGAAATATTAGATAAAAAGACGGATTTAAGATCTACAGAGA

TGACTGAACAATTAAGAGCACTTATTGTTCCTCCGGAGGATCAAGGTTCAGTTTCCAGCACCAACGTGGCAGCTCAAAACCATCTGTAATTCCAGTTCCA

GGGAATCTGATACTCCCCTCTGGTCACTGTGGGTACATGTGATAAAAGTAAAGAGTGATTTTACTTTTCAGTGGAGAGTCATAATGATTGAAGGAGGTTG

TAGAAAGCAGACTAGCTCACAGCAACTTGAAGGTGTATATTCATGAGCCGCTGACTATTTCAGTGTGTGTCATATGTTCCCTGGAACTTTTGTTTTCTTA

AGCCTTGTTGACTGAAATTTTCTCAAATAAAAGCATTTTGACTTTC
Translation
 MDRITDFYFLDFRE ESVKTLIITGNSWRLQEMIDRFFTNISNFNRESLTEIQNIQ IEEIAVNLWNWAVTKRVELSVRKNQAAKL LCYIACKLVYMH

GISVSSEEAIQRQIL MNIKTGKEWLYTGNAQIADEFFQAAMT DLERLYVRLMQSCYTEANVCVYKMIVEKGIFHVLSYQAES AVAQGDFKKASMCVL

RCKDMLMRLPNM TKYLHVLCYNLGIEASKRNKYKESSFWLG - UNI27466 - GQSYEIGKMDRRSVEPQML AKTLRLLATIYLNCGGEAYYTKAF

IAILIANK EHLHPAGLFLKMRILMKGNSCNEELLEA AAKEILYLAMPLEFYLSIIQFLIDNKR RESVGFRFLRIISDNFKSPEDRKRILLFYIDTLL

QKDQDMIAEEKIKDVLKG GYQTRSRLSRDLVNWLHNILWGKASRSVK VQKYADALHWYSYSLKLYEYDKADLDLIKLKRNMVSCYLSLKQLDK AKEA

IAEVEQKDPTHVFTRYYIFKIAIMEGDAFRA ALQVVSALKKSLMDGESEDRGLIEAGVSTLTILSLSIDFALE - UNI27853 - NGQQFVAERALE

YLCQLSKDPKEVLGGLK KCLMRIILPQAFHMPESEYK KKKEMGRLWNYLNTA ALLKFSEYFNEAPSTLDYMVNDANWFRKIA AWNLAVQSEKDLEA

MKNFFMVSYK LSLFCPLDQGLLIAQKTCLLVAAAVDLDRGRKAPTICEQ QNMLLRTALEQIKKCKKVWNLLKKTG GDFSGDDCGVLLLLYEFEVKTK

TNDPSLSRFVDSVWKMPDLECRTLETMAL - UNI27727 - LLAMDKPAYYPTIAHKAMKKLLLMYRKQEPVDVLKYS SVCMHNLIKLLVADEVWNI

SLYPLKEVQSHFKNTLSIIRQN EGYPEEEIVWLMIKSWNIGILMSSKNKYISAERWAAMALDFLGHLSTLKTSYEAK VNLLYANLMEILDKKTDLRST

EMTEQLRALIVPPEDQGSVSSTNVAAQNHL
Transcript ENSMUST00000009814
Sequence
GAGAGACGGAGACGGAGTCGGAGACGCGAGACGCCAGCAAGCGTTTCGGGTGTGGGAGAGCAGACGCCTCCCTGTTTAACAACTTTCTCCTGGATTTGCA

GCTTCCTCAACGTCCCTGCACCTTCAG GCTGGAGCCAGACATTTAAAAAATGGACCGCATTACTGACTTTTACTTCTTGGACTTCAGAG AATCTGTTA

AAACCCTGATCATAACTGGTAATTCATGGAGACTACAAGAAATGATTGACAGATTCTTCACAAACATATCAAATTTCAACAGAGAGTCTCTGACTGAAAT

ACAGAATATTCAG ATTGAAGAAATTGCAGTGAACCTGTGGAACTGGGCAGTTACTAAGAGAGTAGAACTGTCTGTGAGGAAAAACCAGGCAGCTAAAC 

TGTGTTATATTGCTTGCAAGCTGGTATATATGCATGGAATCTCAGTCTCTTCAGAAGAAGCTATTCAAAGACAGATTTTG ATGAATATAAAAACAGGAA

AAGAGTGGTTGTATACTGGAAATGCTCAGATTGCTGATGAATTTTTTCAAGCTGCCATGACT GATCTGGAGAGATTATATGTCAGATTAATGCAGAGCT

GCTACACCGAGGCCAACGTGTGTGTGTATAAGATGATTGTTGAGAAAGGCATCTTCCATGTGCTTTCTTACCAAGCTGAGTCA GCTGTTGCTCAAGGGG

ATTTCAAGAAAGCATCTATGTGCGTCTTACGTTGCAAAGATATGCTGATGAGACTCCCTAACATG ACAAAATATCTTCATGTACTCTGTTACAACCTTG

GCATAGAAGCAAGCAAGCGGAATAAATACAAAGAGAGTTCATTCTGGCTTGG - UNI27466 - CCAAAGCTATGAAATTGGGAAGATGGATAGGCGT

TCTGTTGAGCCACAAATGCTG GCTAAAACGCTGCGGTTACTAGCCACTATTTATTTGAATTGTGGTGGCGAAGCATATTATACCAAGGCCTTCATTGCT

ATACTCATTGCAAACAAG GAACATTTACATCCAGCTGGGCTTTTCTTAAAGATGAGGATCCTCATGAAAGGCAACTCATGTAATGAAGAACTCCTTGAA

G CTGCTAAGGAAATACTATATCTTGCTATGCCTTTGGAATTCTATCTGAGCATTATTCAATTCCTGATAGATAATAAAAG AGAGTCTGTTGGGTTTCG

CTTTCTGAGAATCATCTCTGACAATTTTAAGTCGCCAGAAGATAGGAAGAGAATTCTGTTGTTCTACATTGACACGCTTTTACAAAAGGATCAAGACATG

ATTGCTGAAGAGAAGATTAAAGACGTCCTTAAAG GTTACCAAACAAGAAGTCGACTGTCAAGAGATTTGGTAAATTGGTTACACAACATTCTGTGGGGA

AAGGCTTCCAGAAGTGTTAAG GTCCAAAAATATGCTGATGCCCTACACTGGTACAGTTATTCTCTGAAGTTGTATGAGTATGATAAAGCAGATCTGGAT

TTGATCAAGCTGAAGAGGAACATGGTTTCCTGTTACTTATCTTTGAAACAACTTGATAAG GCTAAAGAGGCCATAGCAGAAGTTGAGCAAAAGGATCCT

ACACATGTTTTCACTCGGTATTATATATTCAAGATCGCAATCATGGAGGGTGATGCTTTCAGAG CTTTACAGGTGGTCAGTGCTTTAAAGAAATCATTA

ATGGATGGAGAATCAGAAGATCGTGGACTAATTGAAGCTGGAGTTTCAACTCTCACAATCCTAAGTTTATCTATAGATTTTGCTCTAGAG - UNI2785

3 - AATGGACAGCAATTTGTGGCAGAAAGAGCTTTGGAATATTTATGTCAACTTTCAAAAGACCCAAAAGAAGTACTTGGAGGTTTAAA GTGTCTCAT

GCGGATTATTCTTCCACAAGCTTTTCATATGCCAGAATCTGAATATAA AAAGAAAGAAATGGGTAGACTTTGGAACTACTTGAATACAG CACTCCTGA

AATTTTCTGAATATTTTAATGAAGCTCCCTCAACTTTGGATTATATGGTTAATGATGCCAATTGGTTCAGGAAAATAG CTTGGAACTTAGCTGTGCAAT

CTGAGAAGGATCTAGAGGCAATGAAAAACTTTTTCATGGTTTCTTATAAG CTGTCCCTTTTTTGTCCTTTGGATCAAGGACTACTGATTGCACAGAAAA

CGTGTTTACTTGTAGCAGCTGCAGTTGATCTGGATAGAGGAAGAAAAGCTCCAACAATTTGTGAGCAG AACATGTTACTAAGAACAGCACTTGAGCAGA

TAAAGAAATGCAAAAAAGTTTGGAATCTCCTGAAAAAAACAG GGGACTTCTCAGGTGATGACTGTGGGGTATTGCTTCTGCTCTATGAATTTGAAGTTA

AAACCAAAACGAATGATCCATCACTGAGCAGATTTGTGGATTCAGTTTGGAAGATGCCTGATTTAGAATGCAGAACACTTGAAACAATGGCAT - UNI2

7727 - TACTAGCTATGGATAAACCTGCATACTATCCTACTATTGCACATAAGGCCATGAAAAAACTTTTATTGATGTACAGAAAACAGGAGCCAGTTG

ATGTTTTAAAATACAG CGTATGCATGCACAACTTGATTAAACTTCTGGTGGCAGATGAAGTATGGAATATATCGCTGTATCCCCTAAAAGAAGTTCAGA

GCCATTTTAAAAATACTCTGAGCATCATTCGCCAAAAC GAAGGATACCCAGAAGAGGAGATTGTATGGCTAATGATCAAGTCTTGGAATATTGGAATAC

TGATGTCTAGCAAGAACAAGTATATATCTGCAGAAAGGTGGGCTGCAATGGCATTGGATTTCCTTGGCCACCTTAGCACCCTCAAAACAAGCTATGAAGC

AAAG GTGAATCTTCTGTATGCCAACCTCATGGAAATATTAGATAAAAAGACGGATTTAAGATCTACAGAGATGACTGAACAATTAAGAGCACTTATTGT

TCCTCCGGAGGATCAAGGTTCAGTTTCCAGCACCAACGTGGCAGCTCAAAACCATCTGTAATTCCAGTTCCAGGGAATCTGATACTCCCCTCTGGTCACT

GTGGGTACATGTGATAAAAGTAAAGAGTGATTTTACTTTTCAGTGGAGAGTCATAATGATTGAAGGAGGTTGTAGAAAGCAGACTAGCTCACAGCAACTT

GAAGGTGTATATTCATGAGCCGCTGACTATTTCAGTGTGTGTCATATGTTCCCTGGAACTTTTGTTTTCTTAAGCCTTGTTGACTGAAATTTTCTCAAAT

AAAAGCATTTTGACTTTC
Translation
 MDRITDFYFLDFRE ESVKTLIITGNSWRLQEMIDRFFTNISNFNRESLTEIQNIQ IEEIAVNLWNWAVTKRVELSVRKNQAAKL LCYIACKLVYMH

GISVSSEEAIQRQIL MNIKTGKEWLYTGNAQIADEFFQAAMT DLERLYVRLMQSCYTEANVCVYKMIVEKGIFHVLSYQAES AVAQGDFKKASMCVL

RCKDMLMRLPNM TKYLHVLCYNLGIEASKRNKYKESSFWLG - UNI27466 - GQSYEIGKMDRRSVEPQML AKTLRLLATIYLNCGGEAYYTKAF

IAILIANK EHLHPAGLFLKMRILMKGNSCNEELLEA AAKEILYLAMPLEFYLSIIQFLIDNKR RESVGFRFLRIISDNFKSPEDRKRILLFYIDTLL

QKDQDMIAEEKIKDVLKG GYQTRSRLSRDLVNWLHNILWGKASRSVK VQKYADALHWYSYSLKLYEYDKADLDLIKLKRNMVSCYLSLKQLDK AKEA

IAEVEQKDPTHVFTRYYIFKIAIMEGDAFRA ALQVVSALKKSLMDGESEDRGLIEAGVSTLTILSLSIDFALE - UNI27853 - NGQQFVAERALE

YLCQLSKDPKEVLGGLK KCLMRIILPQAFHMPESEYK KKKEMGRLWNYLNTA ALLKFSEYFNEAPSTLDYMVNDANWFRKIA AWNLAVQSEKDLEA

MKNFFMVSYK LSLFCPLDQGLLIAQKTCLLVAAAVDLDRGRKAPTICEQ NMLLRTALEQIKKCKKVWNLLKKTG GDFSGDDCGVLLLLYEFEVKTKT

NDPSLSRFVDSVWKMPDLECRTLETMAL - UNI27727 - LLAMDKPAYYPTIAHKAMKKLLLMYRKQEPVDVLKYS SVCMHNLIKLLVADEVWNIS

LYPLKEVQSHFKNTLSIIRQN EGYPEEEIVWLMIKSWNIGILMSSKNKYISAERWAAMALDFLGHLSTLKTSYEAK VNLLYANLMEILDKKTDLRSTE

MTEQLRALIVPPEDQGSVSSTNVAAQNHL

For any suggestions or comments, please send an email to unitrap@crg.es