Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000009733 (Tcfcp2)
Chromosomal location
Chr 15: 100333230 - 100382439 (-)
Description
transcription factor CP2 Gene [Source:MGI Symbol;Acc:MGI:98509]
RefSeq_dna
NM_033476 
RefSeq_peptide
NP_258437.1 
UniGene
Mm.219040 Mm.460267 
MGI
MGI:98509 
Uniprot/SWISSPROT
Q9ERA0 
Uniprot/SPTREMBL
Q3URS4 
Human Ortholog
ENSG00000135457 (TFCP2)
Omim not available
UniTrap UNI1826
Vector Insertion
Chr 15: 100358978 - 100381755
Public Clones BC0250 (sanger) IST10899H10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4276
Vector Insertion
Chr 15: 100356104 - 100358307
Public Clones AH0443 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1259
Vector Insertion
Chr 15: 100351147 - 100352819
Public Clones DD0677 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29077
Vector Insertion
Chr 15: 100348470 - 100349000
Public Clones not available
Private Clones OST9515 (lexicon)
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100199
Sequence
GGGTTTGCGCTTCGAGTCTGCGCCGAACTTTCGCTGTCCACGCTTCCAGGCGGTCGTGGTGGCTAAGGAGGGTGTGGGGACGGCTCGGAGGAACCCTGG 

GAGCCGGCGCCTGTTGGGGCAAGGAAGGAGCCGGGATGGCCTGGGCTCTGAAGCTGCCGCTAGCCGACGAAGTGATCGAGTCGGGGCTTGTGCAGGACTT

TGATGCTAGCCTGTCCGGCATTGGCCAGGAACTGGGTGCTGGTGCTTATAGTATGAG - UNI1826 - TGATGTCCTCGCATTGCCCATTTTTAAGCA

AGAAGAGTCAAGTTTGCCTCCCGATAATGAGAACGAGATTCTGCCTTTTCAGTATGTGCTCTGTGCTGCCACGTCTCCAGCGGTGAAGCTCCACGACGAG

ACCCTGACGTACCTCAATCAAGGTCAG TCTTATGAAATCCGAATGCTAGACAATAGAAAACTGGGAGAGCTTCCAGAACTCAACGGCAAGCTGGTGAAG

 - UNI4276 - AGCATATTCCGCGTAGTGTTCCACGACAGGCGACTGCAGTACACTGAGCACCAGCAGCTGGAGGGCTGGAGGTGGAACCGACCGGGA

GACAGGATTCTCGACATAG ATATCCCAATGTCTGTGGGTGTAATTGATCCCAGGGCCAATCCTACCCAGCTAAACACAGTGGAGTTCCTGTGGGACCCT

TCAAAGAGGACATCTGTGTTTATTCAG - UNI1259 - GTGCACTGCATCAGCACTGAGTTCACCATGAGGAAGCATGGCGGGGAGAAGGGGGTGCCG

TTCCGAGTGCAGATCGATACCTTCAAGGAGAACGGGAACGGAGAGTACACAGAGCACTTGCACTCGGCCAGCTGCCAGATCAAAGTCTTCAAG CCTAAG

GGTGCAGACAGAAAACAAAAAATAGATAGAGAGAAAATGGAGAAACGGACGCCCCATGAAAAAGAGAAATATCAACCTTCTTATGAGACAACCATACTCA

CCGAG - UNI29077 - TGTTCTCCGTGGCCTGAGATCACCTACGTCAACAATTCCCCATCCCCTGGCTTCAACAGCTCCCATAGCAGTTTCTCTCTT

GGGGAAGG AAACGGCTCGCCCAACCACCAGCCAGAACCACCCCCTCCAGTCACGGAT AACCTCTTGCCGACAACCACGCCTCAGGAAGCCCAGCAATG

GCTGCATCGAAACCGGTTCTCCACATTCACGAGGCTTTTCACCAACTTCTCAG GGGCAGATTTACTGAAACTAACTAGAGACGACGTGATCCAAATCTG

CGGCCCTGCAGATGGAATCAGACTCTTTAATGCATTAAAAGGCCG GATGGTGCGGCCAAGGCTAACCATTTATGTCTGCCAGGAGTCGTTGCAGTTGAG

GGAGCAGCAGCCGCAGCCGCAGCCGCAGCCGCAGAAGCAGGAGGATGGGGATTCAAACGGTACTTTCTTCG TGTACCATGCTATCTATCTCGAGGAGCT

GACAGCTGTCGAACTCACAGAAAAAATTGCTCAGCTTTTCAGCATTTCTCCTCACCAGATCAGCCAGATTTACAAGCAAGGGCCGACAGGGATCCATGTG

GTCATCAGCGATGAG GTAGTTTTGAGCTGCCTGATACTGCCAGGAACTGAACTCTGGTCCTCTGGGAGAACAGCAGGCACCCTTAACCACTGTCTAGCC

CTTCCCTTCCTTTAA
Translation
 MAWALKLPLADEVIESGLVQDFDASLSGIGQELGAGAYSMS - UNI1826 - SDVLALPIFKQEESSLPPDNENEILPFQYVLCAATSPAVKLHDET

LTYLNQGQ SYEIRMLDNRKLGELPELNGKLVK - UNI4276 - SIFRVVFHDRRLQYTEHQQLEGWRWNRPGDRILDID DIPMSVGVIDPRANPTQ

LNTVEFLWDPSKRTSVFIQ - UNI1259 - VHCISTEFTMRKHGGEKGVPFRVQIDTFKENGNGEYTEHLHSASCQIKVFK PKGADRKQKIDREKME

KRTPHEKEKYQPSYETTILTE - UNI29077 - CSPWPEITYVNNSPSPGFNSSHSSFSLGEG GNGSPNHQPEPPPPVTD NLLPTTTPQEAQQWLH

RNRFSTFTRLFTNFSG GADLLKLTRDDVIQICGPADGIRLFNALKGR RMVRPRLTIYVCQESLQLREQQPQPQPQPQKQEDGDSNGTFFV VYHAIYL

EELTAVELTEKIAQLFSISPHQISQIYKQGPTGIHVVISDE VVLSCLILPGTELWSSGRTAGTLNHCLALPFL
Transcript ENSMUST00000009877
Sequence
GGGTTTGCGCTTCGAGTCTGCGCCGAACTTTCGCTGTCCACGCTTCCAGGCGGTCGTGGTGGCTAAGGAGGGTGTGGGGACGGCTCGGAGGAACCCTGG 

GAGCCGGCGCCTGTTGGGGCAAGGAAGGAGCCGGGATGGCCTGGGCTCTGAAGCTGCCGCTAGCCGACGAAGTGATCGAGTCGGGGCTTGTGCAGGACTT

TGATGCTAGCCTGTCCGGCATTGGCCAGGAACTGGGTGCTGGTGCTTATAGTATGAG - UNI1826 - TGATGTCCTCGCATTGCCCATTTTTAAGCA

AGAAGAGTCAAGTTTGCCTCCCGATAATGAGAACGAGATTCTGCCTTTTCAGTATGTGCTCTGTGCTGCCACGTCTCCAGCGGTGAAGCTCCACGACGAG

ACCCTGACGTACCTCAATCAAG GACAGTCTTATGAAATCCGAATGCTAGACAATAGAAAACTGGGAGAGCTTCCAGAACTCAACGGCAAGCTGGTGAAG

 - UNI4276 - AGCATATTCCGCGTAGTGTTCCACGACAGGCGACTGCAGTACACTGAGCACCAGCAGCTGGAGGGCTGGAGGTGGAACCGACCGGGA

GACAGGATTCTCGACATAG ATATCCCAATGTCTGTGGGTGTAATTGATCCCAGGGCCAATCCTACCCAGCTAAACACAGTGGAGTTCCTGTGGGACCCT

TCAAAGAGGACATCTGTGTTTATTCAG - UNI1259 - GTGCACTGCATCAGCACTGAGTTCACCATGAGGAAGCATGGCGGGGAGAAGGGGGTGCCG

TTCCGAGTGCAGATCGATACCTTCAAGGAGAACGGGAACGGAGAGTACACAGAGCACTTGCACTCGGCCAGCTGCCAGATCAAAGTCTTCAAG CCTAAG

GGTGCAGACAGAAAACAAAAAATAGATAGAGAGAAAATGGAGAAACGGACGCCCCATGAAAAAGAGAAATATCAACCTTCTTATGAGACAACCATACTCA

CCGAG - UNI29077 - TGTTCTCCGTGGCCTGAGATCACCTACGTCAACAATTCCCCATCCCCTGGCTTCAACAGCTCCCATAGCAGTTTCTCTCTT

GGGGAAGG AAACGGCTCGCCCAACCACCAGCCAGAACCACCCCCTCCAGTCACGGAT AACCTCTTGCCGACAACCACGCCTCAGGAAGCCCAGCAATG

GCTGCATCGAAACCGGTTCTCCACATTCACGAGGCTTTTCACCAACTTCTCAG GGGCAGATTTACTGAAACTAACTAGAGACGACGTGATCCAAATCTG

CGGCCCTGCAGATGGAATCAGACTCTTTAATGCATTAAAAGGCCG GATGGTGCGGCCAAGGCTAACCATTTATGTCTGCCAGGAGTCGTTGCAGTTGAG

GGAGCAGCAGCCGCAGCCGCAGCCGCAGCCGCAGAAGCAGGAGGATGGGGATTCAAACGGTACTTTCTTCG TGTACCATGCTATCTATCTCGAGGAGCT

GACAGCTGTCGAACTCACAGAAAAAATTGCTCAGCTTTTCAGCATTTCTCCTCACCAGATCAGCCAGATTTACAAGCAAGGGCCGACAGGGATCCATGTG

GTCATCAGCGATGAG ATGGTACAGAACTTCCAGGAAGAAGCCTGCTTTATTCTGGACACGATGGAAG CAGAAACCAGTGACAGCTATCATGTCATTCT

CAAGTAGGGTGAGGCCCCGACCTTCGACGGCTGCTGCTGCCTTCCCCTCTTCACCTTCTGAAGGGGACATGACTGGAGATTAAAGGGCTTCAGGAACCTG

GCACATCTGAATGTTGGGGGGAGGGGGGAGGCGTGTCCAGTGCAGGGCGAGCAGGTCCCAAGGAGGAATCCCAGAGTCCTGTATTGGCTCCTCTGATCAC

TGGCTATACATGGAGCCAGCAGTTTCCTTACTTTCTGGCCCCTGTTGATACCAGTAAGAAGCCCCGTCATTAGGGTTTGTAGAGGGCAGAGTGGTAATGG

GAGTCATGTGATGTTTTCTAGGAAGATGTTTAGTTTTGTGATATAGAGCTCTGACATTTTACTGATATAAAAGTGAACATCTGTCTTCATAAAACCAAGC

TCTCTCTCTTGCCTCAAGCCTGTTGGCAGCTCTGCTCTGCTCTGTTCACAACTGTGAGGAGGAGAAACAGAATCTCTCCTTCCCTTTTTTGAGACAGGGT

TTCATGTTCTTGCCTCTACCTCCCAAGAGCTGGGATCACAAGCTTTTGCCACCTGGTCTGTTTCTGTCTGCAGTGCTGGGCTTGAACTCGGAGCCTCACG

TGCTAGGCAGGCACTTTCTCCAGCTGAGCTCCAGCAGGCCTTCCCTTTAGTGCTAAGACAGGCTCCAGATTTCTAATTTGGTTCACCTGCAATACCACAG

CTGAGTGTGATTTTGGCTAATGTGTATTGGGGTAGACCGAATGATAAATCCCACGGACGGATAATCTTCTTTTATCCCCTTAATAAACCCAAAACATCTG

GGGACACAGTGACTTGAGGGTGAGGAGACGCAGATGAAGTGGAGGGGCTTCTGACAACACCAGATGCCACCCTTTGCTGCCAGTGCTCACCACTGGGTCT

TTCTGGGGCTCTGCTGGAAACTGACGGACTTCCCACTGAAGGAGGCAACCATACCTTACCACTGTAGCGATAATGAAGCCCCAGACAGACAGACACCCAA

TGTCACACTAACCTCAGCCCAGAGCTAGAGGTGAGAGAGACAAGCGTGTCTGACCCCAGGCTTCGTTGTTCGTGAATGATATTCTCAAAACTGTTTAAGT

AAATGAGCTATTCCGCCCTGCTCTCCCCTCCCCTGTCTTGTTTTGGCATAGTGTGGTGTTTTTTTTTTTTTTTTTGTTCTTTTTTTAAAATGTAAGCTTT

ATTAAAAAAAGAAAAATACATTCTTTTCCTATTCAAACTCACACTGTGTTTATGTTCTGCCTTTCAAATGGCTGTGTGTCTGTGTGCATGTACAGAATTG

TAAAGCACTTAGGCCCTCCTTTTTCACATGAAGTTTGTTTTAGCTTGGTTTTCCAAGAAAACGTTTCTCTGTGGAGCCCCGGCTGTCCTGGAACTCACTC

TGTAGACCAGGCTGGCCTCAAACTCAGAAATCCACCTTCCAAGTGCTGGGAATATAGGTGTGTGCCACTAGCTTAGTCAGGCCACATGTAAAGTTTTACC

AGAAATTCCCTTAAATTTTGTTGAGATGAACAAAGATAATGTTAAAGATTCTGTATTAAATTTGAATTTATGTGTGTTTTTGAAGTATTTAATAAAGCTT

AGATTTTTTTATAG
Translation
 MAWALKLPLADEVIESGLVQDFDASLSGIGQELGAGAYSMS - UNI1826 - SDVLALPIFKQEESSLPPDNENEILPFQYVLCAATSPAVKLHDET

LTYLNQG GQSYEIRMLDNRKLGELPELNGKLVK - UNI4276 - SIFRVVFHDRRLQYTEHQQLEGWRWNRPGDRILDID DIPMSVGVIDPRANPT

QLNTVEFLWDPSKRTSVFIQ - UNI1259 - VHCISTEFTMRKHGGEKGVPFRVQIDTFKENGNGEYTEHLHSASCQIKVFK PKGADRKQKIDREKM

EKRTPHEKEKYQPSYETTILTE - UNI29077 - CSPWPEITYVNNSPSPGFNSSHSSFSLGEG GNGSPNHQPEPPPPVTD NLLPTTTPQEAQQWL

HRNRFSTFTRLFTNFSG GADLLKLTRDDVIQICGPADGIRLFNALKGR RMVRPRLTIYVCQESLQLREQQPQPQPQPQKQEDGDSNGTFFV VYHAIY

LEELTAVELTEKIAQLFSISPHQISQIYKQGPTGIHVVISDE MVQNFQEEACFILDTMEA AETSDSYHVILK
Transcript ENSMUST00000108921
Sequence
GGGTTTGCGCTTCGAGTCTGCGCCGAACTTTCGCTGTCCACGCTTCCAGGCGGTCGTGGTGGCTAAGGAGGGTGTGGGGACGGCTCGGAGGAACCCTGG 

GAGCCGGCGCCTGTTGGGGCAAGGAAGGAGCCGGGATGGCCTGGGCTCTGAAGCTGCCGCTAGCCGACGAAGTGATCGAGTCGGGGCTTGTGCAGGACTT

TGATGCTAGCCTGTCCGGCATTGGCCAGGAACTGGGTGCTGGTGCTTATAGTATGAG - UNI1826 - TGATGTCCTCGCATTGCCCATTTTTAAGCA

AGAAGAGTCAAGTTTGCCTCCCGATAATGAGAACGAGATTCTGCCTTTTCAGTATGTGCTCTGTGCTGCCACGTCTCCAGCGGTGAAGCTCCACGACGAG

ACCCTGACGTACCTCAATCAAGGTCAG TCTTATGAAATCCGAATGCTAGACAATAGAAAACTGGGAGAGCTTCCAGAACTCAACGGCAAGCTGGTGAAG

 - UNI4276 - AGCATATTCCGCGTAGTGTTCCACGACAGGCGACTGCAGTACACTGAGCACCAGCAGCTGGAGGGCTGGAGGTGGAACCGACCGGGA

GACAGGATTCTCGACATAG ATATCCCAATGTCTGTGGGTGTAATTGATCCCAGGGCCAATCCTACCCAGCTAAACACAGTGGAGTTCCTGTGGGACCCT

TCAAAGAGGACATCTGTGTTTATTCAG - UNI1259 - GTGCACTGCATCAGCACTGAGTTCACCATGAGGAAGCATGGCGGGGAGAAGGGGGTGCCG

TTCCGAGTGCAGATCGATACCTTCAAGGAGAACGGGAACGGAGAGTACACAGAGCACTTGCACTCGGCCAGCTGCCAGATCAAAGTCTTCAAG CCTAAG

GGTGCAGACAGAAAACAAAAAATAGATAGAGAGAAAATGGAGAAACGGACGCCCCATGAAAAAGAGAAATATCAACCTTCTTATGAGACAACCATACTCA

CCGAG - UNI29077 - TGTTCTCCGTGGCCTGAGATCACCTACGTCAACAATTCCCCATCCCCTGGCTTCAACAGCTCCCATAGCAGTTTCTCTCTT

GGGGAAGG AAACGGCTCGCCCAACCACCAGCCAGAACCACCCCCTCCAGTCACGGAT AACCTCTTGCCGACAACCACGCCTCAGGAAGCCCAGCAATG

GCTGCATCGAAACCGGTTCTCCACATTCACGAGGCTTTTCACCAACTTCTCAG GGGCAGATTTACTGAAACTAACTAGAGACGACGTGATCCAAATCTG

CGGCCCTGCAGATGGAATCAGACTCTTTAATGCATTAAAAGGCCG GATGGTGCGGCCAAGGCTAACCATTTATGTCTGCCAGGAGTCGTTGCAGTTGAG

GGAGCAGCAGCCGCAGCCGCAGCCGCAGCCGCAGAAGCAGGAGGATGGGGATTCAAACGGTACTTTCTTCG TGTACCATGCTATCTATCTCGAGGAGCT

GACAGCTGTCGAACTCACAGAAAAAATTGCTCAGCTTTTCAGCATTTCTCCTCACCAGATCAGCCAGATTTACAAGCAAGGGCCGACAGGGATCCATGTG

GTCATCAGCGATGAG ATGGTACAGAACTTCCAGGAAGAAGCCTGCTTTATTCTGGACACGATGGAAG CAGAAACCAGTGACAGCTATCATGTCATTCT

CAAGTAGGGTGAGGCCCCGACCTTCGACGGCTGCTGCTGCCTTCCCCTCTTCACCTTCTGAAGGGGACATGACTGGAGATTAAAGGGCTTCAGGAACCTG

GCACATCTGAATGTTGGGGGGAGGGGGGAGGCGTGTCCAGTGCAGGGCGAGCAGGTCCCAAGGAGGAATCCCAGAGTCCTGTATTGGCTCCTCTGATCAC

TGGCTATACATGGAGCCAGCAGTTTCCTTACTTTCTGGCCCCTGTTGATACCAGTAAGAAGCCCCGTCATTAGGGTTTGTAGAGGGCAGAGTGGTAATGG

GAGTCATGTGATGTTTTCTAGGAAGATGTTTAGTTTTGTGATATAGAGCTCTGACATTTTACTGATATAAAAGTGAACATCTGTCTTCATAAAACCAAGC

TCTCTCTCTTGCCTCAAGCCTGTTGGCAGCTCTGCTCTGCTCTGTTCACAACTGTGAGGAGGAGAAACAGAATCTCTCCTTCCCTTTTTTGAGACAGGGT

TTCATGTTCTTGCCTCTACCTCCCAAGAGCTGGGATCACAAGCTTTTGCCACCTGGTCTGTTTCTGTCTGCAGTGCTGGGCTTGAACTCGGAGCCTCACG

TGCTAGGCAGGCACTTTCTCCAGCTGAGCTCCAGCAGGCCTTCCCTTTAGTGCTAAGACAGGCTCCAGATTTCTAATTTGGTTCACCTGCAATACCACAG

CTGAGTGTGATTTTGGCTAATGTGTATTGGGGTAGACCGAATGATAAATCCCACGGACGGATAATCTTCTTTTATCCCCTTAATAAACCCAAAACATCTG

GGGACACAGTGACTTGAGGGTGAGGAGACGCAGATGAAGTGGAGGGGCTTCTGACAACACCAGATGCCACCCTTTGCTGCCAGTGCTCACCACTGGGTCT

TTCTGGGGCTCTGCTGGAAACTGACGGACTTCCCACTGAAGGAGGCAACCATACCTTACCACTGTAGCGATAATGAAGCCCCAGACAGACAGACACCCAA

TGTCACACTAACCTCAGCCCAGAGCTAGAGGTGAGAGAGACAAGCGTGTCTGACCCCAGGCTTCGTTGTTCGTGAATGATATTCTCAAAACTGTTTAAGT

AAATGAGCTATTCCGCCCTGCTCTCCCCTCCCCTGTCTTGTTTTGGCATAGTGTGGTGTTTTTTTTTTTTTTTTTGTTCTTTTTTTAAAATGTAAGCTTT

ATTAAAAAAAGAAAAATACATTCTTTTCCTATTCAAACTCACACTGTGTTTATGTTCTGCCTTTCAAATGGCTGTGTGTCTGTGTGCATGTACAGAATTG

TAAAGCACTTAGGCCCTCCTTTTTCACATGAAGTTTGTTTTAGCTTGGTTTTCCAAGAAAACGTTTCTCTGTGGAGCCCCGGCTGTCCTGGAACTCACTC

TGTAGACCAGGCTGGCCTCAAACTCAGAAATCCACCTTCCAAGTGCTGGGAATATAGGTGTGTGCCACTAGCTTAGTCAGGCCACATGTAAAGTTTTACC

AGAAATTCCCTTAAATTTTGTTGAGATGAACAAAGATAATGTTAAAGATTCTGTATTAAATTTGAATTTATGTGTGTTTTTGAAGTATTTAATAAAGCTT

AGATTTTTTTATAG
Translation
 MAWALKLPLADEVIESGLVQDFDASLSGIGQELGAGAYSMS - UNI1826 - SDVLALPIFKQEESSLPPDNENEILPFQYVLCAATSPAVKLHDET

LTYLNQGQ SYEIRMLDNRKLGELPELNGKLVK - UNI4276 - SIFRVVFHDRRLQYTEHQQLEGWRWNRPGDRILDID DIPMSVGVIDPRANPTQ

LNTVEFLWDPSKRTSVFIQ - UNI1259 - VHCISTEFTMRKHGGEKGVPFRVQIDTFKENGNGEYTEHLHSASCQIKVFK PKGADRKQKIDREKME

KRTPHEKEKYQPSYETTILTE - UNI29077 - CSPWPEITYVNNSPSPGFNSSHSSFSLGEG GNGSPNHQPEPPPPVTD NLLPTTTPQEAQQWLH

RNRFSTFTRLFTNFSG GADLLKLTRDDVIQICGPADGIRLFNALKGR RMVRPRLTIYVCQESLQLREQQPQPQPQPQKQEDGDSNGTFFV VYHAIYL

EELTAVELTEKIAQLFSISPHQISQIYKQGPTGIHVVISDE MVQNFQEEACFILDTMEA AETSDSYHVILK

For any suggestions or comments, please send an email to unitrap@crg.es