Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000009772 (Nuak2)
Chromosomal location
Chr 1: 134212714 - 134229865 (+)
Description
NUAK family, SNF1-like kinase, 2 Gene [Source:MGI (curated);Acc:Nuak2-002]
RefSeq_dna
NM_028778 
RefSeq_peptide
NP_083054.1 
UniGene
Mm.100666 Mm.408786 
MGI
MGI:1921387 
Uniprot/SWISSPROT
Q8BZN4 
Human Ortholog
ENSG00000163545 (NUAK2)
Omim not available
UniTrap UNI33689
Vector Insertion
Chr 1: 134213050 - 134221529
Public Clones IST12935D5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31753
Vector Insertion
Chr 1: 134222807 - 134224273
Public Clones IST14730F8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20565
Vector Insertion
Chr 1: 134227269 - 134227897
Public Clones not available
Private Clones OST358657 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000082125
Sequence
AGCGTGCTCGGGTGCGGCTGTGACCTCTGAGCCCGCGGCTCAGCGCGCGCTGCTACTGCTGCCCGACCCACTCCACCTCGCGGTCCCCGCACCATGGAGT

CGGTGGCCTTACTCCAGCGCCCGAGCCAGGCTCCCTCGGCCTCCGCCCTGGCCTCGGAGAGCGCCCGGCCGCTGGCGGACGGGCTCATCAAGTCGCCTAA

ACCTCTGATGAAGAAGCAGGCGGTGAAGCGGCACCATCACAAACACAACCTGCGGCACCGCTACGAGTTCCTGGAGACGCTGGGCAAGGGCACCTACGGG

AAGGTGAAGAAGGCACGAGAGAGCTCGGGGCGTCTG - UNI33689 - GTGGCCATCAAGTCCATCAGGAAAGACAAAATCAAAGATGAGCAGGATCT

GCTGCACATACGGAGGGAGATTGAGATCATGTCTTCACTCAACCACCCCCACATCATTGCCATCCATGAAG - UNI31753 - TGTTTGAGAATAGCA

GCAAGATTGTGATTGTCATGGAGTATGCCAGCCGAGGCGATCTGTATGATTACATCAGTGAGCGGCCACGGCTGAGTGAGCGGGACGCCAGGCATTTCTT

CCGACAGATCGTGTCTGCCCTGCACTACTGCCACCAG AACGGGATCGTTCACCGAGATCTCAAGCTGGAAAACATCCTTCTAGATGCCAATGGAAACAT

CAAG ATTGCTGACTTTGGCCTCTCCAACCTGTACCACAAAGGCAAGTTCCTCCAGACGTTCTGTGGGAGCCCTCTCTACGCCTCGCCTGAGATAGTCAA

CGGGAAGCCCTATGTGGGCCCAGAG GTGGACAGCTGGTCTCTGGGCGTTCTCCTGTACATCCTGGTGCATGGCACCATGCCCTTTGACGGGCAGGATCA

TAAAACACTGGTGAAGCAAATCAGTAACGGGGCTTACCGTGAGCCGCCCAAGCCGTCCG - UNI20565 - ATGCCTGTGGCCTGATCCGGTGGCTGT

TAATGGTGAACCCCACCCGTCGGGCCACACTGGAGGATGTAGCCAGTCATTGGTGGGTCAACTGGGGTTACACCACCGGAGTCGGGGAACAGGAAGCCCT

GCGTGAGGGTGGGCACCCTAGTGGTGACTTTGGCCGGGCCTCCATGGCGGACTGGTTACGTCGCTCCTCGCGCCCCCTCCTGGAGAATGGAGCCAAGGTG

TGCAGCTTCTTCAAGCAGCACGTGCCGGGAGGTGGAAGCACTGTACCTGGGCTGGAGCGGCAACATTCTCTTAAGAAGTCCCGAAAGGAGAATGACATGG

CTCAAAATCTGCAAGGTGACCCGGCTGAGGATACCTCTTCTCGCCCTGGCAAGAGCAGCCTTAAGCTTCCGAAAGGCATTCTCAAGAAAAAGTCCTCTAC

CTCGTCAGGGGAGGTACAGGAGGACCCTCAGGAACTCAGACCGGTGCCTGATACTCCAGGGCAGCCTGTCCCTGCTGTATCCCTGCTCCCAAGGAAAGGC

ATCCTTAAGAAGTCTCGACAGCGTGAATCTGGTTACTACTCCTCTCCAGAGCCCAGCGAGTCTGGGGAACTCTTAGACGCCAGTGATGTGTTTGTGAGTG

GGGACCCCGTGGAGCAGAAGTCTCCACAGGCTTCAGGGCTCCTCCTCCACCGCAAGGGCATTCTCAAACTCAATGGCAAGTTCTCCCGCACAGCCTTAGA

AGGCACTACCCCTAGCACCTTTGGCTCCCTGGACCAACTGGCCTCCTCCCATCCTGCAGCCCGGCCCAGCCGCCCCTCAGGGGCTGTGAGTGAGGACAGC

ATCCTGTCCTCCGAGTCCTTTGACCAATTGGACTTGCCTGAACGTCTTCCCGAAACCCCACTGAGGGGCTGTGTGTCTGTGGACAACCTGAGGGGGCTTG

AGCAGCCTCCCTCAGAAGGTCTGAAGCGATGGTGGCAGGAATCCTTGGGGGATAGCTGCTTTTCTCTGACAGACTGCCAAGAGGTGACTGCAGCCTACAG

ACAAGCCCTAGGAATCTGCTCAAAGCTCAGCTGAGGAAGGGAGATGGTGCCCTAGTATGGGGTAGGCTCTGAGAGGGTTTGCAGAGGAACCCTGGGTCGG

ATTCCTCCAGTGAATAGAGTACATCAAGGGCTCTACGTCTGCAGCCTGACTGAACCTGAAAGATGAGAGAAATCGCATTGATGTGGAAAGGAATGGGAAC

CCTTGCTGCCCGAGTGTTATAGTGGGGTGGCCTGAAGGTGCCTACCTCCTTTGTGCCATGAGTGTCACCCATGACATTTCCCACCCTGTTCTCTGGCTGC

ACCTTCACATAAGTTTCTGTTTCCATCAACCACCAGGGTTAGAACCCTGACTTCCTGGGAGGTAATGTGTAGTGACTGCCATTATTTAGAGAGGAAACAG

CCTCTGGTTTCCATCTCTGCTGCTGTGCATCTCAAAGACCTGGGAAGACTCGGACCGCTGTTTGACTTCATCTCAAGGGGACCAGATGCCCCTGGACCCC

ATCTTAGATCTCAGAGACTTGAACCTTGAAGCTGTTCCTAGTACCCAGATGTGGATGGATGCTCTGTTTCTCAGGCCAACGGGACCTAGAATGTGCTGAC

TTATTTATTTTTTTGTGATTCTCACTTCTGTTTTTTGGTTTTTGTTTGTTTGTTTGTTTTTGTTTTTAAGTGAATTTTGCTGCTTTCAATAATGTGAATG

CTGTGTTCTGGGGAACTCCACTGTGCCACTGAAGTTTATGTACAGAGAAGTATTTGGCAATGATGTCCCTCTATTCAAGGGGGGTGGGGGCGTTTTTCAA

ATGTATGTCTTGAGCACTGTCTGGATTGAGTCTCCAGTCCCTTCACACCCAAGGCTGGCCACCCTCCCTCATCTTCATCTGTGGCCAAAAAAAAAAAAAA

AAAAAAAAACAACCCTCATTAAAACCAGCAGTGGTAACTGG
Translation
MESVALLQRPSQAPSASALASESARPLADGLIKSPKPLMKKQAVKRHHHKHNLRHRYEFLETLGKGTYGKVKKARESSGRL - UNI33689 - VAIKS

IRKDKIKDEQDLLHIRREIEIMSSLNHPHIIAIHEV - UNI31753 - VFENSSKIVIVMEYASRGDLYDYISERPRLSERDARHFFRQIVSALHYCH

Q NGIVHRDLKLENILLDANGNIK IADFGLSNLYHKGKFLQTFCGSPLYASPEIVNGKPYVGPE VDSWSLGVLLYILVHGTMPFDGQDHKTLVKQISN

GAYREPPKPSD - UNI20565 - DACGLIRWLLMVNPTRRATLEDVASHWWVNWGYTTGVGEQEALREGGHPSGDFGRASMADWLRRSSRPLLENGAK

VCSFFKQHVPGGGSTVPGLERQHSLKKSRKENDMAQNLQGDPAEDTSSRPGKSSLKLPKGILKKKSSTSSGEVQEDPQELRPVPDTPGQPVPAVSLLPRK

GILKKSRQRESGYYSSPEPSESGELLDASDVFVSGDPVEQKSPQASGLLLHRKGILKLNGKFSRTALEGTTPSTFGSLDQLASSHPAARPSRPSGAVSED

SILSSESFDQLDLPERLPETPLRGCVSVDNLRGLEQPPSEGLKRWWQESLGDSCFSLTDCQEVTAAYRQALGICSKLS
Transcript ENSMUST00000072177
Sequence
AGCGTGCTCGGGTGCGGCTGTGACCTCTGAGCCCGCGGCTCAGCGCGCGCTGCTACTGCTGCCCGACCCACTCCACCTCGCGGTCCCCGCACCATGGAGT

CGGTGGCCTTACTCCAGCGCCCGAGCCAGGCTCCCTCGGCCTCCGCCCTGGCCTCGGAGAGCGCCCGGCCGCTGGCGGACGGGCTCATCAAGTCGCCTAA

ACCTCTGATGAAGAAGCAGGCGGTGAAGCGGCACCATCACAAACACAACCTGCGGCACCGCTACGAGTTCCTGGAGACGCTGGGCAAGGGCACCTACGGG

AAGGTGAAGAAGGCACGAGAGAGCTCGGGGCGTCTG - UNI33689 - GTGGCCATCAAGTCCATCAGGAAAGACAAAATCAAAGATGAGCAGGATCT

GCTGCACATACGGAGGGAGATTGAGATCATGTCTTCACTCAACCACCCCCACATCATTGCCATCCATGAAG TGGGCAGATCACGCTTAGTGACTG - U

NI31753 - TGTTTGAGAATAGCAGCAAGATTGTGATTGTCATGGAGTATGCCAGCCGAGGCGATCTGTATGATTACATCAGTGAGCGGCCACGGCTGA

GTGAGCGGGACGCCAGGCATTTCTTCCGACAGATCGTGTCTGCCCTGCACTACTGCCACCAG AACGGGATCGTTCACCGAGATCTCAAGCTGGAAAACA

TCCTTCTAGATGCCAATGGAAACATCAAG ATTGCTGACTTTGGCCTCTCCAACCTGTACCACAAAGGCAAGTTCCTCCAGACGTTCTGTGGGAGCCCTC

TCTACGCCTCGCCTGAGATAGTCAACGGGAAGCCCTATGTGGGCCCAGAG GTGGACAGCTGGTCTCTGGGCGTTCTCCTGTACATCCTGGTGCATGGCA

CCATGCCCTTTGACGGGCAGGATCATAAAACACTGGTGAAGCAAATCAGTAACGGGGCTTACCGTGAGCCGCCCAAGCCGTCCG - UNI20565 - AT

GCCTGTGGCCTGATCCGGTGGCTGTTAATGGTGAACCCCACCCGTCGGGCCACACTGGAGGATGTAGCCAGTCATTGGTGGGTCAACTGGGGTTACACCA

CCGGAGTCGGGGAACAGGAAGCCCTGCGTGAGGGTGGGCACCCTAGTGGTGACTTTGGCCGGGCCTCCATGGCGGACTGGTTACGTCGCTCCTCGCGCCC

CCTCCTGGAGAATGGAGCCAAGGTGTGCAGCTTCTTCAAGCAGCACGTGCCGGGAGGTGGAAGCACTGTACCTGGGCTGGAGCGGCAACATTCTCTTAAG

AAGTCCCGAAAGGAGAATGACATGGCTCAAAATCTGCAAGGTGACCCGGCTGAGGATACCTCTTCTCGCCCTGGCAAGAGCAGCCTTAAGCTTCCGAAAG

GCATTCTCAAGAAAAAGTCCTCTACCTCGTCAGGGGAGGTACAGGAGGACCCTCAGGAACTCAGACCGGTGCCTGATACTCCAGGGCAGCCTGTCCCTGC

TGTATCCCTGCTCCCAAGGAAAGGCATCCTTAAGAAGTCTCGACAGCGTGAATCTGGTTACTACTCCTCTCCAGAGCCCAGCGAGTCTGGGGAACTCTTA

GACGCCAGTGATGTGTTTGTGAGTGGGGACCCCGTGGAGCAGAAGTCTCCACAGGCTTCAGGGCTCCTCCTCCACCGCAAGGGCATTCTCAAACTCAATG

GCAAGTTCTCCCGCACAGCCTTAGAAGGCACTACCCCTAGCACCTTTGGCTCCCTGGACCAACTGGCCTCCTCCCATCCTGCAGCCCGGCCCAGCCGCCC

CTCAGGGGCTGTGAGTGAGGACAGCATCCTGTCCTCCGAGTCCTTTGACCAATTGGACTTGCCTGAACGTCTTCCCGAAACCCCACTGAGGGGCTGTGTG

TCTGTGGACAACCTGAGGGGGCTTGAGCAGCCTCCCTCAGAAGGTCTGAAGCGATGGTGGCAGGAATCCTTGGGGGATAGCTGCTTTTCTCTGACAGACT

GCCAAGAGGTGACTGCAGCCTACAGACAAGCCCTAGGAATCTGCTCAAAGCTCAGCTGAGGAAGGGAGATGGTGCCCTAGTATGGGGTAGGCTCTGAGAG

GGTTTGCAGAGGAACCCTGGGTCGGATTCCTCCAGTGAATAGAGTACATCAAGGGCTCTACGTCTGCAGCCTGACTGAACCTGAAAGATGAGAGAAATCG

CATTGATGTGGAAAGGAATGGGAACCCTTGCTGCCCGAGTGTTATAGTGGGGTGGCCTGAAGGTGCCTACCTCCTTTGTGCCATGAGTGTCACCCATGAC

ATTTCCCACCCTGTTCTCTGGCTGCACCTTCACATAAGTTTCTGTTTCCATCAACCACCAGGGTTAGAACCCTGACTTCCTGGGAGGTAATGTGTAGTGA

CTGCCATTATTTAGAGAGGAAACAGCCTCTGGTTTCCATCTCTGCTGCTGTGCATCTCAAAGACCTGGGAAGACTCGGACCGCTGTTTGACTTCATCTCA

AGGGGACCAGATGCCCCTGGACCCCATCTTAGATCTCAGAGACTTGAACCTTGAAGCTGTTCCTAGTACCCAGATGTGGATGGATGCTCTGTTTCTCAGG

CCAACGGGACCTAGAATGTGCTGACTTATTTATTTTTTTGTGATTCTCACTTCTGTTTTTTGGTTTTTGTTTGTTTGTTTGTTTTTGTTTTTAAGTGAAT

TTTGCTGCTTTCAATAATGTGAATGCTGTGTTCTGGGGAACTCCACTGTGCCACTGAAGTTTATGTACAGAGAAGTATTTGGCAATGATGTCCCTCTATT

CAAGGGGGGTGGGGGCGTTTTTCAAATGTATGTCTTGAGCACTGTCTGGATTGAGTCTCCAGTCCCTTCACACCCAAGGCTGGCCACCCTCCCTCATCTT

CATCTGTGGCCAAAAAAAAAAAAAAAAAAAAAAACAACCCTCATTAAAACCAGCAGTGGTAACTGG
Translation
MESVALLQRPSQAPSASALASESARPLADGLIKSPKPLMKKQAVKRHHHKHNLRHRYEFLETLGKGTYGKVKKARESSGRL - UNI33689 - VAIKS

IRKDKIKDEQDLLHIRREIEIMSSLNHPHIIAIHEV VGRSRLVTV - UNI31753 - VFENSSKIVIVMEYASRGDLYDYISERPRLSERDARHFFR

QIVSALHYCHQ NGIVHRDLKLENILLDANGNIK IADFGLSNLYHKGKFLQTFCGSPLYASPEIVNGKPYVGPE VDSWSLGVLLYILVHGTMPFDGQD

HKTLVKQISNGAYREPPKPSD - UNI20565 - DACGLIRWLLMVNPTRRATLEDVASHWWVNWGYTTGVGEQEALREGGHPSGDFGRASMADWLRRS

SRPLLENGAKVCSFFKQHVPGGGSTVPGLERQHSLKKSRKENDMAQNLQGDPAEDTSSRPGKSSLKLPKGILKKKSSTSSGEVQEDPQELRPVPDTPGQP

VPAVSLLPRKGILKKSRQRESGYYSSPEPSESGELLDASDVFVSGDPVEQKSPQASGLLLHRKGILKLNGKFSRTALEGTTPSTFGSLDQLASSHPAARP

SRPSGAVSEDSILSSESFDQLDLPERLPETPLRGCVSVDNLRGLEQPPSEGLKRWWQESLGDSCFSLTDCQEVTAAYRQALGICSKLS

For any suggestions or comments, please send an email to unitrap@crg.es