Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000009828 (Ick)
Chromosomal location
Chr 9: 77956999 - 78015745 (+)
Description
intestinal cell kinase Gene [Source:MGI (curated);Acc:Ick-004]
RefSeq_dna
NM_019987 
RefSeq_peptide
NP_064371.1 
MGI
MGI:1934157 
Uniprot/SWISSPROT
Q9JKV2 
Uniprot/SPTREMBL
Q3UZZ3 Q3U4K6 Q3V314 Q69ZV0 
Human Ortholog
ENSG00000112144 (ICK)
Omim not available
UniTrap UNI16176
Vector Insertion
Chr 9: 77961263 - 77979101
Public Clones IST10548H8 (tigm) IST14674D3 (tigm)
Private Clones OST465664 (lexicon) OST464362 (lexicon) OST456569 (lexicon) OST456131 (lexicon)
OST441711 (lexicon) OST441691 (lexicon) OST431715 (lexicon) OST373185 (lexicon)
OST372186 (lexicon) OST305702 (lexicon) OST277397 (lexicon) OST181307 (lexicon)
OST148347 (lexicon) OST59009 (lexicon) OST38916 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13573
Vector Insertion
Chr 9: 78001544 - 78003155
Public Clones CMHD-GT_322B10-3 (cmhd) CMHD-GT_319A02-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14086
Vector Insertion
Chr 9: 78014840 - 78015406
Public Clones CMHD-GT_139A7-3 (cmhd) PSTVU02.H51 (vanderbilt)
Private Clones OST448070 (lexicon) OST28259 (lexicon) OST17585 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000117330
Sequence
GTTTGTTTTGCTGCCGGAGGCCGCGGAGCGGCGGGTTCCTGCTGGATGCCACGCGCTGACGGGTGTGGACTTGCCGGGTTCGCCCGCTCGGATCCCACTG

CCCTTGCCTGCCGGGCCCTCTCGGGTGCACGCGCCGCCGGGCCGCGATCGCCGCCA - UNI16176 - GCAGAAGACTGAGCTTTGAAAATATGTATT

TGGGAGATAATCACGTTCTGTTGAATACCTTGTGCTGGTGCTGCCATCGAAAAATCTGGTTACAGTCTGGGGAGGCCTGCTACCATTGCAGGACTGAACC

GCCTCGGCCCTGAGATGAGTGTCCCGACAGAGCAGGCGCACGCACCATGAATAGATACACAACGATCAAGCAGCTTGGGGATGGGACCTACGGCTCTGTC

CTGCTGGGGAGAAGCATTGAGTCTGGAGAACTGATTGCCATTAAAAA AATGAAAAGAAAGTTTTACTCCTGGGAAGAATGCATGAACCTTCGGGAGGTT

AAG TCTTTAAAGAAGCTTAATCATGCCAATATCGTAAAGTTAAAAGAGGTTATCAGGGAAAACGACCATCTTTACTTTATCTTCGAGTACATGAAGGAA

AACCTTTACCAGCTCATTAAAGAAAG AAATAAGTTGTTTCCAGAGTCTGCTATAAGGAATATAATGTACCAGATATTGCAAGGACTGGCATTCATTCAC

AAACACG GTTTCTTCCACCGGGACTTAAAACCCGAGAACCTCCTCTGCATGGGACCAGAACTTGTGAAAATCGCCGACTTTGGATTGGCTCGAGAAATC

CGATCAAGACCTCCGTACACAGACTATGTGTCTACTAGATG GTACAGGGCTCCAGAGGTACTGCTGAGATCCACCAACTACAGCTCCCCCATTGACATC

TGGGCGGTAGGCTGCATCATGGCGGAGGTGTACACGCTCCGGCCCCTTTTCCCTGGGGCCAGTGAAATTGACACAATTTTCAAAATTTGCCAAGTGTTGG

GAACACCAAAGAAG - UNI13573 - ACTGACTGGCCTGAAGGCTACCAGCTGTCAAGTGCTATGAATTTCCTCTGGCCCCAGTGCATACCCAATAAC

TTAAAGACTCTAATCCCAAATGCTAGCAGCGAAGCCATTCAGCTCCTGAGAGACTTGCTTCAGTGGGATCCCAAGAAACGACCAACCGCTAGTCAG GCT

CTTCGATATCCTTACTTCCAGATCGGACACCCACTGGGCATCATCAGCAAGGACTCAGGAAAACCACAGAGAGAGGTCCAGGACAAGACAGGCCCTCCTC

CTTACATCAAGCCAGCCCCTCCTGCCCAGGCCCCGGCCAAGGCATATACGCTGATTTCTTCACGACCAAGCCAAGCCAGTCAGCCCCCTCAGCATTCTGT

GCACCCCTACAAAGGCGATGTCTCTAGGACTGAGCAGCTGAGCCATGTTCAGGAGGGCAAGCCAAGCCCTCCATTCTTCCCATCCCTCCACAATAAGAAT

CTTCAGCCA AAAATCCTAGCCAGCCTGGAACAGAAAAATGGTGAAATCAAGCCAAAGAGCAGGAGAAGATGGGGTCTCATCTCCAGGTCGACAAAGGGT

TCTGACGACTGGGCCGACTTGGATGACTTAGACTTCAGTCCCTCTCTCACCAGGATAGATGTAAAAAACAAGAAGAGACAGAGTGATGACACCCTCTGCA

G GTTTGAAAGTGTTCTGGACCTGAAGCCATCTGAGTCAGTGGGTACAGGAACCACTGTCTCCACGCAGGCTTCCTCGCAGAGGAGAGACACGCCGACCC

TGCAGTCCTCAGCAAAGCAGCACTACTTGAAGCACTCTCGCTACTTGCCTG GAATAAATATAAGAAATGGCGTGCTCCCAAATCCAGGCAAGGACTTTC

TTCCATCAAATTCATGGTCCAGTTCCGGCTTGTCTGGAAAATCTTCAGGAACAGTATCAGTAGTGAGCAAAATAACTTCAGGCAAGTAACAGTTATTAAC

TCCTGAGTGACCAGAGGCCAATTCTCCTGATGTTGTGGGGCTGGAGGAAGTCTCCTAGAGAACTATGGCATGGGGCCCTTCTGTCTGAGACGCAGGCATC

TCTTCAGTTTCCCTGCCCTGCTCTCCCTTTTGTAGCAGCCCTAGGGGTTCAGCCAGCTCCCCAAAGGTTCTGTCCTCAGGGGAGGTTGGGAGTGGAGCAG

TCCTCCCTGACCCAGGAGGAAGCCAAAAACCAAGTTTACAGACTTACCAAATCTAACCTCGGATGCCCTGCTGTGCTTTGGACACCTGGCTCCTAAAGTC

AGTGTTAGTCTGGACTTCTCTGCTGGACTTCCTGACTGTGAACCTGCCCTGCCCAGAGCAGCAGAGTCCCTTCTGGTTGGAAAGTGGACAGACTGTTTTT

TAAAATAAAGTCCTCCAAAATGGCTAGCCAGGTAGACAATTTCCCCGTGCTGTTTCCCTGGCCGAGTGCTCTACACGGCACCCAGTGCACACCTAACCCT

CGCCGCTCCCCGGAACCTTCTTACATTAGGGTTCATGTAGGAATGCCGTGCCCAGGTACCCGTCATGCCACCGAAGAACACATGTAAGCCCCCGTGGCCC

ACCCTACATACCAGGCCTGATGGAATGTCAACTTTTCCTGTGCATTTAAAAAGTTATATATAAAAGTCAGTGAGCTTTGCATAGTTTAAAGTTTATAGGA

ATGCTTCCTTTTAAAAAATAAAGTGTGTAGCAAGT
Translation
 - UNI16176 - MNRYTTIKQLGDGTYGSVLLGRSIESGELIAIKK KMKRKFYSWEECMNLREVK SLKKLNHANIVKLKEVIRENDHLYFIFEYMK

ENLYQLIKER RNKLFPESAIRNIMYQILQGLAFIHKHG GFFHRDLKPENLLCMGPELVKIADFGLAREIRSRPPYTDYVSTRW WYRAPEVLLRSTNY

SSPIDIWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKK - UNI13573 - TDWPEGYQLSSAMNFLWPQCIPNNLKTLIPNASSEAIQLLRD

LLQWDPKKRPTASQ ALRYPYFQIGHPLGIISKDSGKPQREVQDKTGPPPYIKPAPPAQAPAKAYTLISSRPSQASQPPQHSVHPYKGDVSRTEQLSHVQ

EGKPSPPFFPSLHNKNLQP KILASLEQKNGEIKPKSRRRWGLISRSTKGSDDWADLDDLDFSPSLTRIDVKNKKRQSDDTLCR RFESVLDLKPSESVG

TGTTVSTQASSQRRDTPTLQSSAKQHYLKHSRYLPG GINIRNGVLPNPGKDFLPSNSWSSSGLSGKSSGTVSVVSKITSGK
Transcript ENSMUST00000118869
Sequence
ACCCCCAACCCGGTGCCACTTCTTACAGTCCAAACATCCGATTCCACGTCAATAGAAGGCACTTGGATTGCACATTTTAGAACTTTTTCACCTACAGGCA

TATGCTAGCAAAACTTACGGGCTTCCTGGCCTCTGACAGACATTTAGACAACATTTATTGAGTTTCTGTAAGTGTTAGAACCTAACAGCCAGGACGCTAC

ATTCACCCGACTTCACAGAACTTAAAATTTTATTGTGCTACTTTATTCTGGAGCTCAGAAATGAAGTACGTCTTCGGCAAAGACATGGAG - UNI1617

6 - GCAGAAGACTGAGCTTTGAAAATATGTATTTGGGAGATAATCACGTTCTGTTGAATACCTTGTGCTGGTGCTGCCATCGAAAAATCTGGTTACAGT

CTGGGGAGGCCTGCTACCATTGCAGGACTGAACCGCCTCGGCCCTGAGATGAGTGTCCCGACAGAGCAGGCGCACGCACCATGAATAGATACACAACGAT

CAAGCAGCTTGGGGATGGGACCTACGGCTCTGTCCTGCTGGGGAGAAGCATTGAGTCTGGAGAACTGATTGCCATTAAAAA AATGAAAAGAAAGTTTTA

CTCCTGGGAAGAATGCATGAACCTTCGGGAGGTTAAG TCTTTAAAGAAGCTTAATCATGCCAATATCGTAAAGTTAAAAGAGGTTATCAGGGAAAACGA

CCATCTTTACTTTATCTTCGAGTACATGAAGGAAAACCTTTACCAGCTCATTAAAGAAAG AAATAAGTTGTTTCCAGAGTCTGCTATAAGGAATATAAT

GTACCAGATATTGCAAGGACTGGCATTCATTCACAAACACG GTTTCTTCCACCGGGACTTAAAACCCGAGAACCTCCTCTGCATGGGACCAGAACTTGT

GAAAATCGCCGACTTTGGATTGGCTCGAGAAATCCGATCAAGACCTCCGTACACAGACTATGTGTCTACTAGATG GTACAGGGCTCCAGAGGTACTGCT

GAGATCCACCAACTACAGCTCCCCCATTGACATCTGGGCGGTAGGCTGCATCATGGCGGAGGTGTACACGCTCCGGCCCCTTTTCCCTGGGGCCAGTGAA

ATTGACACAATTTTCAAAATTTGCCAAGTGTTGGGAACACCAAAGAAG - UNI13573 - ACTGACTGGCCTGAAGGCTACCAGCTGTCAAGTGCTAT

GAATTTCCTCTGGCCCCAGTGCATACCCAATAACTTAAAGACTCTAATCCCAAATGCTAGCAGCGAAGCCATTCAGCTCCTGAGAGACTTGCTTCAGTGG

GATCCCAAGAAACGACCAACCGCTAGTCAG GCTCTTCGATATCCTTACTTCCAGATCGGACACCCACTGGGCATCATCAGCAAGGACTCAGGAAAACCA

CAGAGAGAGGTCCAGGACAAGACAGGCCCTCCTCCTTACATCAAGCCAGCCCCTCCTGCCCAGGCCCCGGCCAAGGCATATACGCTGATTTCTTCACGAC

CAAGCCAAGCCAGTCAGCCCCCTCAGCATTCTGTGCACCCCTACAAAGGCGATGTCTCTAGGACTGAGCAGCTGAGCCATGTTCAGGAGGGCAAGCCAAG

CCCTCCATTCTTCCCATCCCTCCACAATAAGAATCTTCAGCCA AAAATCCTAGCCAGCCTGGAACAGAAAAATGGTGAAATCAAGCCAAAGAGCAGGAG

AAGATGGGGTCTCATCTCCAGGTCGACAAAGGGTTCTGACGACTGGGCCGACTTGGATGACTTAGACTTCAGTCCCTCTCTCACCAGGATAGATGTAAAA

AACAAGAAGAGACAGAGTGATGACACCCTCTGCAG GTTTGAAAGTGTTCTGGACCTGAAGCCATCTGAGTCAGTGGGTACAGGAACCACTGTCTCCACG

CAGGCTTCCTCGCAGAGGAGAGACACGCCGACCCTGCAGTCCTCAGCAAAGCAGCACTACTTGAAGCACTCTCGCTACTTGCCTG GAATAAATATAAGA

AATGGCGTGCTCCCAAATCCAGGCAAGGACTTTCTTCCATCAAATTCATGGTCCAGTTCCGGCTTGTCTGGAAAATCTTCAGGAACAGTATCAGTAGTGA

GCAAAATAACTTCAG TTGGCTCAGGCTCTGCGAGCTCTAGTGGACTGACTGGAAGCTACATTCCTTCCTTTCTGAAAAAGGAAATCGGTTCTGTCATGC

AGAGGGTTCAGCTGGCGCCCCTCGCAGCCCCTCCCCCCG - UNI14086 - GCTACTCTTCCCTCAAGGCCGTGAGACCTCACCCGGGGAGGCCTTTC

TTTCACACCCAGCCCAGGAGCACGCCCGGCTTGATCCCCCGACCTCCAGCTGCTCAGCCTGTGCACGGCAGGATAGACTGGTCTTCCAAGTACCCATCCC

GGCGGTGACTGTCCCGGCCACGGGCCGTGCTCCTCAGCTGGCTCCATTGTACCCGCACAACCACGAGGCGGTGTAAAACAACCCACACTTACAGCTGTTC

TGAACTAATACATTTCAATATTTCTTTTAAATTTTTTTTAAAACATTGATTTGAATGCAATACCCTCTTTTTGTATAAAATTATTTTATTCT
Translation
 - UNI16176 - MNRYTTIKQLGDGTYGSVLLGRSIESGELIAIKK KMKRKFYSWEECMNLREVK SLKKLNHANIVKLKEVIRENDHLYFIFEYMK

ENLYQLIKER RNKLFPESAIRNIMYQILQGLAFIHKHG GFFHRDLKPENLLCMGPELVKIADFGLAREIRSRPPYTDYVSTRW WYRAPEVLLRSTNY

SSPIDIWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKK - UNI13573 - TDWPEGYQLSSAMNFLWPQCIPNNLKTLIPNASSEAIQLLRD

LLQWDPKKRPTASQ ALRYPYFQIGHPLGIISKDSGKPQREVQDKTGPPPYIKPAPPAQAPAKAYTLISSRPSQASQPPQHSVHPYKGDVSRTEQLSHVQ

EGKPSPPFFPSLHNKNLQP KILASLEQKNGEIKPKSRRRWGLISRSTKGSDDWADLDDLDFSPSLTRIDVKNKKRQSDDTLCR RFESVLDLKPSESVG

TGTTVSTQASSQRRDTPTLQSSAKQHYLKHSRYLPG GINIRNGVLPNPGKDFLPSNSWSSSGLSGKSSGTVSVVSKITSV VGSGSASSSGLTGSYIPS

FLKKEIGSVMQRVQLAPLAAPPPG - UNI14086 - GYSSLKAVRPHPGRPFFHTQPRSTPGLIPRPPAAQPVHGRIDWSSKYPSRR
Transcript ENSMUST00000044551
Sequence
GGAGGCCGCGGAGCGGCGGGTTCCTGCTGGATGCCACGCGCTGACGGGTGTGGACTTGCCGGGTTCGCCCGCTCGGATCCCACTGCCCTTGCCTGCCGGG

CCCTCTCGGGTGCACGCGCCGCCGGGCCGCGATCGCCGCCA - UNI16176 - GCAGAAGACTGAGCTTTGAAAATATGTATTTGGGAGATAATCACG

TTCTGTTGAATACCTTGTGCTGGTGCTGCCATCGAAAAATCTGGTTACAGTCTGGGGAGGCCTGCTACCATTGCAGGACTGAACCGCCTCGGCCCTGAGA

TGAGTGTCCCGACAGAGCAGGCGCACGCACCATGAATAGATACACAACGATCAAGCAGCTTGGGGATGGGACCTACGGCTCTGTCCTGCTGGGGAGAAGC

ATTGAGTCTGGAGAACTGATTGCCATTAAAAA AATGAAAAGAAAGTTTTACTCCTGGGAAGAATGCATGAACCTTCGGGAGGTTAAG TCTTTAAAGAA

GCTTAATCATGCCAATATCGTAAAGTTAAAAGAGGTTATCAGGGAAAACGACCATCTTTACTTTATCTTCGAGTACATGAAGGAAAACCTTTACCAGCTC

ATTAAAGAAAG AAATAAGTTGTTTCCAGAGTCTGCTATAAGGAATATAATGTACCAGATATTGCAAGGACTGGCATTCATTCACAAACACG GTTTCTT

CCACCGGGACTTAAAACCCGAGAACCTCCTCTGCATGGGACCAGAACTTGTGAAAATCGCCGACTTTGGATTGGCTCGAGAAATCCGATCAAGACCTCCG

TACACAGACTATGTGTCTACTAGATG GTACAGGGCTCCAGAGGTACTGCTGAGATCCACCAACTACAGCTCCCCCATTGACATCTGGGCGGTAGGCTGC

ATCATGGCGGAGGTGTACACGCTCCGGCCCCTTTTCCCTGGGGCCAGTGAAATTGACACAATTTTCAAAATTTGCCAAGTGTTGGGAACACCAAAGAAG 

- UNI13573 - ACTGACTGGCCTGAAGGCTACCAGCTGTCAAGTGCTATGAATTTCCTCTGGCCCCAGTGCATACCCAATAACTTAAAGACTCTAATC

CCAAATGCTAGCAGCGAAGCCATTCAGCTCCTGAGAGACTTGCTTCAGTGGGATCCCAAGAAACGACCAACCGCTAGTCAG GCTCTTCGATATCCTTAC

TTCCAGATCGGACACCCACTGGGCATCATCAGCAAGGACTCAGGAAAACCACAGAGAGAGGTCCAGGACAAGACAGGCCCTCCTCCTTACATCAAGCCAG

CCCCTCCTGCCCAGGCCCCGGCCAAGGCATATACGCTGATTTCTTCACGACCAAGCCAAGCCAGTCAGCCCCCTCAGCATTCTGTGCACCCCTACAAAGG

CGATGTCTCTAGGACTGAGCAGCTGAGCCATGTTCAGGAGGGCAAGCCAAGCCCTCCATTCTTCCCATCCCTCCACAATAAGAATCTTCAGCCA AAAAT

CCTAGCCAGCCTGGAACAGAAAAATGGTGAAATCAAGCCAAAGAGCAGGAGAAGATGGGGTCTCATCTCCAGGTCGACAAAGGGTTCTGACGACTGGGCC

GACTTGGATGACTTAGACTTCAGTCCCTCTCTCACCAGGATAGATGTAAAAAACAAGAAGAGACAGAGTGATGACACCCTCTGCAG GTTTGAAAGTGTT

CTGGACCTGAAGCCATCTGAGTCAGTGGGTACAGGAACCACTGTCTCCACGCAGGCTTCCTCGCAGAGGAGAGACACGCCGACCCTGCAGTCCTCAGCAA

AGCAGCACTACTTGAAGCACTCTCGCTACTTGCCTG GAATAAATATAAGAAATGGCGTGCTCCCAAATCCAGGCAAGGACTTTCTTCCATCAAATTCAT

GGTCCAGTTCCGGCTTGTCTGGAAAATCTTCAGGAACAGTATCAGTAGTGAGCAAAATAACTTCAG TTGGCTCAGGCTCTGCGAGCTCTAGTGGACTGA

CTGGAAGCTACATTCCTTCCTTTCTGAAAAAGGAAATCGGTTCTGTCATGCAGAGGGTTCAGCTGGCGCCCCTCGCAGCCCCTCCCCCCG - UNI1408

6 - GCTACTCTTCCCTCAAGGCCGTGAGACCTCACCCGGGGAGGCCTTTCTTTCACACCCAGCCCAGGAGCACGCCCGGCTTGATCCCCCGACCTCCAG

CTGCTCAGCCTGTGCACGGCAGGATAGACTGGTCTTCCAAGTACCCATCCCGGCGGTGACTGTCCCGGCCACGGGCCGTGCTCCTCAGCTGGCTCCATTG

TACCCGCACAACCACGAGGCGGTGTAAAACAACCCACACTTACAGCTGTTCTGAACTAATACATTTCAATATTTCTTTTAAATTTTTTTTAAAACATTGA

TTTGAATGCAATACCCTCTTTTTGTATAAAATTATTTTATTCT
Translation
 - UNI16176 - MNRYTTIKQLGDGTYGSVLLGRSIESGELIAIKK KMKRKFYSWEECMNLREVK SLKKLNHANIVKLKEVIRENDHLYFIFEYMK

ENLYQLIKER RNKLFPESAIRNIMYQILQGLAFIHKHG GFFHRDLKPENLLCMGPELVKIADFGLAREIRSRPPYTDYVSTRW WYRAPEVLLRSTNY

SSPIDIWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKK - UNI13573 - TDWPEGYQLSSAMNFLWPQCIPNNLKTLIPNASSEAIQLLRD

LLQWDPKKRPTASQ ALRYPYFQIGHPLGIISKDSGKPQREVQDKTGPPPYIKPAPPAQAPAKAYTLISSRPSQASQPPQHSVHPYKGDVSRTEQLSHVQ

EGKPSPPFFPSLHNKNLQP KILASLEQKNGEIKPKSRRRWGLISRSTKGSDDWADLDDLDFSPSLTRIDVKNKKRQSDDTLCR RFESVLDLKPSESVG

TGTTVSTQASSQRRDTPTLQSSAKQHYLKHSRYLPG GINIRNGVLPNPGKDFLPSNSWSSSGLSGKSSGTVSVVSKITSV VGSGSASSSGLTGSYIPS

FLKKEIGSVMQRVQLAPLAAPPPG - UNI14086 - GYSSLKAVRPHPGRPFFHTQPRSTPGLIPRPPAAQPVHGRIDWSSKYPSRR

For any suggestions or comments, please send an email to unitrap@crg.es