Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000009894 (1110031B06Rik)
Chromosomal location
Chr 11: 59220646 - 59263511 (-)
Description
RIKEN cDNA 1110031B06 gene Gene [Source:MGI Symbol;Acc:MGI:1915076]
RefSeq_dna
NM_144521 
RefSeq_peptide
NP_653104.1 
MGI
MGI:1915076 
Uniprot/SWISSPROT
Q8R570 
Uniprot/SPTREMBL
B2FDF7 B2FDF6 
Human Ortholog
ENSG00000143740 (C1orf142)
Omim not available
UniTrap UNI15319
Vector Insertion
Chr 11: 59251479 - 59263510
Public Clones (ggtc) PST6405-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36783
Vector Insertion
Chr 11: 59241842 - 59252016
Public Clones IST14935C3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16029
Vector Insertion
Chr 11: 59221313 - 59235051
Public Clones CMHD-GT_440H11-3 (cmhd) CMHD-GT_297H9-3 (cmhd) CMHD-GT_397D3-3 (cmhd) CMHD-GT_298B12-3 (cmhd)
CMHD-GT_365F1-3 (cmhd) CMHD-GT_502E12-3 (cmhd)
Private Clones OST467610 (lexicon) OST23069 (lexicon) OST19770 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000116373
Sequence
CCGAGTGGCTGACCTGCTCCCCAGCTGCTGGCGTCTCTGTCTGGTGGTCCAGTGGAGCGTGCCATTGCGTCTTCTGCGTGCTCCTCTTGCCTCAG - UN

I15319 - ATACTGCAGCCTCTGGGTAGCCCAGCAACCTAGGAACAGATGAGTTCTGATATGCGTGTCCACTCCTGGTCTTGTTCCTACTATCTGGACC

TTGAGAAGCAATGGGTTTCTGGAAAACTGACCCTGACTCCTCATTCACTGAAGTTCATTGTGGAAAAAACAGAAGAGGTCCTTGTTGGCCTGCCCCTCTC

CAGCATCATTGAGATCAGGAAAGAGTCATCTCTCTTTATCTTCGGTGCGATCACAGTCCTGGAGAAGGGCCAGACCAAGCACTGGTTCAGCTCACTGCAG

CCTAGTCGAAATGTGGTCTTCAACGTCATCGAACATTTCTGGAGGGAGCTGCTACTGTCCCAGCCAGGCACTGCTGCCAACATACCCTCCCACGTGACCA

GGGGACAGGAGCTGATAGGACTGATGGCAAATTCCCAGAAACGCATGGAAGACACAGCGAAGGATCTCCAGCAGCAGAGCGAACAGCTGGACAGCGTCCT

GAAGGGCCTGGAGAAGATGGAGTCCGACCTGGACGTGGCTGACAG - UNI15319 - ATTGCTGACAGAATTGGAGACACCTTCCTGGTGGCCTTTTG

GCTCTAAGTTTTGGAAGATGCCGGCAGAAGAAAATCTCAAGGAAGGTGTGTCTTCCACTTGTGAGCCCTTTGGAAAGGAAGGGGTTGTGATCACGGTCCC

TGCTATTATTTCTGAGAGAGCAGAGTCTCATTCCAAGCTGGGAAAGCTCACTGTCCTGGTCTCCGCTCTGGAAATCTATGACTCCTGCTCGTTGCTCCTG

CACAGATTTGAGAAGGAAGATGTTGATGATATCAAGGTTCACTCTCCTTATGAGGTCAGCATACGCCAGCGCTTCATTGGGAAGCCAGACGTGGCTTACC

AGCTGATATCTGCCAAGATGCCAGAGGTCATTCCCATCTTAGAAGTGCAGTTCAGCAGCAAGATTGAGCTCCTGGAAGACGCCTTAGTGCTCAGGAACAA

GGTCTTTGCTTCCTCTGCAGAGAGGCATGCAG - UNI16029 - CCCCTGCCACCTTTTCCTGATCATCAGTTAGAGTTCTGTAACCAGTAGCCTCTG

TGTGTGCGTAATAAAAGAATGTTTATTCGATGACTT
Translation
 - UNI15319 - MSSDMRVHSWSCSYYLDLEKQWVSGKLTLTPHSLKFIVEKTEEVLVGLPLSSIIEIRKESSLFIFGAITVLEKGQTKHWFSSLQPS

RNVVFNVIEHFWRELLLSQPGTAANIPSHVTRGQELIGLMANSQKRMEDTAKDLQQQSEQLDSVLKGLEKMESDLDVADR - UNI15319 - RLLTEL

ETPSWWPFGS - UNI16029 - 
Transcript ENSMUST00000068575
Sequence
CCGAGTGGCTGACCTGCTCCCCAGCTGCTGGCGTCTCTGTCTGGTGGTCCAGTGGAGCGTGCCATTGCGTCTTCTGCGTGCTCCTCTTGCCTCAG - UN

I15319 - ATACTGCAGCCTCTGGGTAGCCCAGCAACCTAGGAACAGATGAGTTCTGATATGCGTGTCCACTCCTGGTCTTGTTCCTACTATCTGGACC

TTGAGAAGCAATGGGTTTCTGGAAAACTGACCCTGACTCCTCATTCACTGAAGTTCATTGTGGAAAAAACAGAAGAGGTCCTTGTTGGCCTGCCCCTCTC

CAGCATCATTGAGATCAGGAAAGAGTCATCTCTCTTTATCTTCGGTGCGATCACAGTCCTGGAGAAGGGCCAGACCAAGCACTGGTTCAGCTCACTGCAG

CCTAGTCGAAATGTGGTCTTCAACGTCATCGAACATTTCTGGAGGGAGCTGCTACTGTCCCAGCCAGGCACTGCTGCCAACATACCCTCCCACGTGACCA

GGGGACAGGAGCTGATAGGACTGATGGCAAATTCCCAGAAACGCATGGAAGACACAGCGAAGGATCTCCAGCAGCAGAGCGAACAGCTGGACAGCGTCCT

GAAGGGCCTGGAGAAGATGGAGTCCGACCTGGACGTGGCTGACAG - UNI15319 - ATTGCTGACAGAATTGGAGACACCTTCCTGGTGGCCTTTTG

GCTCTAAGTTTTGGAAGATGCCGGCAGAAGAAAATCTCAAGGAAGGTGTGTCTTCCACTTGTGAGCCCTTTGGAAAGGAAGGGGTTGTGATCACGGTCCC

TGCTATTATTTCTGAGAGAGCAGAGTCTCATTCCAAGCTGGGAAAGCTCACTGTCCTGGTCTCCGCTCTGGAAATCTATGACTCCTGCTCGTTGCTCCTG

CACAGATTTGAGAAGGAAGATGTTGATGATATCAAGGTTCACTCTCCTTATGAGGTCAGCATACGCCAGCGCTTCATTGGGAAGCCAGACGTGGCTTACC

AGCTGATATCTGCCAAGATGCCAGAGGTCATTCCCATCTTAGAAGTGCAGTTCAGCAGCAAGATTGAGCTCCTGGAAGACGCCTTAGTGCTCAGG ACAA

GGTCTTTGCTTCCTCTGCAGAGAGGCATGCAG CATCCAGACCGAAGGGCT CACTCCACACCGAGAGCTGCCCACAGGAGGACAGGAAGGCGAGCAGCT

GCAGCTGCAGAAGAACTTGCCACTGTTCTCTGA
Translation
 - UNI15319 - MSSDMRVHSWSCSYYLDLEKQWVSGKLTLTPHSLKFIVEKTEEVLVGLPLSSIIEIRKESSLFIFGAITVLEKGQTKHWFSSLQPS

RNVVFNVIEHFWRELLLSQPGTAANIPSHVTRGQELIGLMANSQKRMEDTAKDLQQQSEQLDSVLKGLEKMESDLDVADR - UNI15319 - RLLTEL

ETPSWWPFGSKFWKMPAEENLKEGVSSTCEPFGKEGVVITVPAIISERAESHSKLGKLTVLVSALEIYDSCSLLLHRFEKEDVDDIKVHSPYEVSIRQRF

IGKPDVAYQLISAKMPEVIPILEVQFSSKIELLEDALVLR TRSLLPLQRGMQ HPDRRA HSTPRAAHRRTGRRAAAAAEELATVL
Transcript ENSMUST00000010038
Sequence
CCGAGTGGCTGACCTGCTCCCCAGCTGCTGGCGTCTCTGTCTGGTGGTCCAGTGGAGCGTGCCATTGCGTCTTCTGCGTGCTCCTCTTGCCTCAG - UN

I15319 - ATACTGCAGCCTCTGGGTAGCCCAGCAACCTAGGAACAGATGAGTTCTGATATGCGTGTCCACTCCTGGTCTTGTTCCTACTATCTGGACC

TTGAGAAGCAATGGGTTTCTGGAAAACTGACCCTGACTCCTCATTCACTGAAGTTCATTGTGGAAAAAACAGAAGAGGTCCTTGTTGGCCTGCCCCTCTC

CAGCATCATTGAGATCAGGAAAGAGTCATCTCTCTTTATCTTCGGTGCGATCACAGTCCTGGAGAAGGGCCAGACCAAGCACTGGTTCAGCTCACTGCAG

CCTAGTCGAAATGTGGTCTTCAACGTCATCGAACATTTCTGGAGGGAGCTGCTACTGTCCCAGCCAGGCACTGCTGCCAACATACCCTCCCACGTGACCA

GGGGACAGGAGCTGATAGGACTGATGGCAAATTCCCAGAAACGCATGGAAGACACAGCGAAGGATCTCCAGCAGCAGAGCGAACAGCTGGACAGCGTCCT

GAAGGGCCTGGAGAAGATGGAGTCCGACCTGGACGTGGCTGACAG - UNI15319 - ATTGCTGACAGAATTGGAGACACCTTCCTGGTGGCCTTTTG

GCTCTAAGTTTTGGAAGATGCCGGCAGAAGAAAATCTCAAGGAAGGTGTGTCTTCCACTTGTGAGCCCTTTGGAAAGGAAGGGGTTGTGATCACGGTCCC

TGCTATTATTTCTGAGAGAGCAGAGTCTCATTCCAAGCTGGGAAAGCTCACTGTCCTGGTCTCCGCTCTGGAAATCTATGACTCCTGCTCGTTGCTCCTG

CACAGATTTGAGAAGGAAGATGTTGATGATATCAAGGTTCACTCTCCTTATGAGGTCAGCATACGCCAGCGCTTCATTGGGAAGCCAGACGTGGCTTACC

AGCTGATATCTGCCAAGATGCCAGAGGTCATTCCCATCTTAGAAGTGCAGTTCAGCAGCAAGATTGAGCTCCTGGAAGACGCCTTAGTGCTCAGGAACAA

GGTCTTTGCTTCCTCTGCAGAGAGGCATGCAG CATCCAGACCGAAGGGCTGCACTCCACACCGAGAGCTGCCCACAGGAGGACAGGAAGGCGAGCAGCT

GCAGCTGCAGAAGAACTTGCCACTGTTCTCTGAGGGGGAAGCCCAGGAGCTGACACAG - UNI16029 - ATCCTGAGCAAAATGAAGGGACTCGCAC

TGGACACTGAGGCAGAGCTGGAACGCCAGGATGCGGCTCTGGATGGCATCACCGTAGCTGTGGACCGGGCAACCCTGAATGTGGACAAGCAAAACCGGCG

TATGAGAAAGCTGATGTAG
Translation
 - UNI15319 - MSSDMRVHSWSCSYYLDLEKQWVSGKLTLTPHSLKFIVEKTEEVLVGLPLSSIIEIRKESSLFIFGAITVLEKGQTKHWFSSLQPS

RNVVFNVIEHFWRELLLSQPGTAANIPSHVTRGQELIGLMANSQKRMEDTAKDLQQQSEQLDSVLKGLEKMESDLDVADR - UNI15319 - RLLTEL

ETPSWWPFGSKFWKMPAEENLKEGVSSTCEPFGKEGVVITVPAIISERAESHSKLGKLTVLVSALEIYDSCSLLLHRFEKEDVDDIKVHSPYEVSIRQRF

IGKPDVAYQLISAKMPEVIPILEVQFSSKIELLEDALVLRNKVFASSAERHAA ASRPKGCTPHRELPTGGQEGEQLQLQKNLPLFSEGEAQELTQ - U

NI16029 - ILSKMKGLALDTEAELERQDAALDGITVAVDRATLNVDKQNRRMRKLM
Transcript ENSMUST00000120940
Sequence
GAGTGGCTGACCTGCTCCCCAGCTGCTGGCGTCTCTGTCTGGTGGTCCAGTGGAGCGTGCCATTGCGTCTTCTGCGTGCTCCTCTTGCCTCAG - UNI1

5319 - ATACTGCAGCCTCTGGGTAGCCCAGCAACCTAGGAACAGATGAGTTCTGATATGCGTGTCCACTCCTGGTCTTGTTCCTACTATCTGGACCTT

GAGAAGCAATGGGTTTCTGGAAAACTGACCCTGACTCCTCATTCACTGAAGTTCATTGTGGAAAAAACAGAAGAGGTCCTTGTTGGCCTGCCCCTCTCCA

GCATCATTGAGATCAGGAAAGAGTCATCTCTCTTTATCTTCGGTGCGATCACAGTCCTGGAGAAGGGCCAGACCAAGCACTGGTTCAGCTCACTGCAGCC

TAGTCGAAATGTGGTCTTCAACGTCATCGAACATTTCTGGAGGGAGCTGCTACTGTCCCAGCCAGGCACTGCTGCCAACATACCCTCCCACGTGACCAGG

GGACAGGAGCTGATAGGACTGATGGCAAATTCCCAGAAACGCATGGAAGACACAGCGAAGGATCTCCAGCAGCAGAGCGAACAGCTGGACAGCGTCCTGA

AGGGCCTGGAGAAGATGGAGTCCGACCTGGACGTGGCTGACAG - UNI15319 - ATTGCTGACAGAATTGGAGACACCTTCCTGGTGGCCTTTTGGC

TCTAAGTTTTGGAAGATGCCGGCAGAAGAAAATCTCAAGGAAGGTGTGTCTTCCACTTGTGAGCCCTTTGGAAAGGAAGGGGTTGTGATCACGGTCCCTG

CTATTATTTCTGAGAGAGCAGAGTCTCATTCCAAGCTGGGAAAGCTCACTGTCCTGGTCTCCGCTCTGGAAATCTATGACTCCTGCTCGTTGCTCCTGCA

CAGATTTGAGAAGGAAGATGTTGATGATATCAAGGTTCACTCTCCTTATGAGGTCAGCATACGCCAGCGCTTCATTGGGAAGCCAGACGTGGCTTACCAG

CTGATATCTGCCAAGATGCCAGAGGTCATTCCCATCTTAGAAGTGCAGTTCAGCAGCAAGATTGAGCTCCTGGAAGACGCCTTAGTGCTCAGGAACAAGG

TCTTTGCTTCCTCTGCAGAGAGGCATGCAG - UNI16029 - CCCCTGCCACCTTTTCCTGATCATCAGTTAGAGTTCTGTAACCAGTAGCCTCTGTG

TGTGCGTAATAAAAGAATGTTTATTCGATGACTT
Translation
 - UNI15319 - MSSDMRVHSWSCSYYLDLEKQWVSGKLTLTPHSLKFIVEKTEEVLVGLPLSSIIEIRKESSLFIFGAITVLEKGQTKHWFSSLQPS

RNVVFNVIEHFWRELLLSQPGTAANIPSHVTRGQELIGLMANSQKRMEDTAKDLQQQSEQLDSVLKGLEKMESDLDVADR - UNI15319 - RLLTEL

ETPSWWPFGSKFWKMPAEENLKEGVSSTCEPFGKEGVVITVPAIISERAESHSKLGKLTVLVSALEIYDSCSLLLHRFEKEDVDDIKVHSPYEVSIRQRF

IGKPDVAYQLISAKMPEVIPILEVQFSSKIELLEDALVLRNKVFASSAERHAA - UNI16029 - APATFS

For any suggestions or comments, please send an email to unitrap@crg.es