Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000010048 (Ifrd2)
Chromosomal location
Chr 9: 107490049 - 107495369 (+)
Description
interferon-related developmental regulator 2 Gene [Source:MGI Symbol;Acc:MGI:1316708]
RefSeq_dna
NM_025903 
RefSeq_peptide
NP_080179.1 
MGI
MGI:1316708 
Uniprot/SPTREMBL
Q7TSB3 Q9CW96 Q9D8U0 
Human Ortholog
ENSG00000214706 (IFRD2)
Omim not available
UniTrap UNI5891
Vector Insertion
Chr 9: 107490278 - 107492233
Public Clones YHD416 (baygenomics) (ggtc) D067A02 (ggtc) IST14977F4 (tigm) IST14677B2 (tigm)
IST14854E5 (tigm)
Private Clones OST252729 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000010192
Sequence
GACAGGGCGGGGCGCCTCACGAAGATGGTGGCGCGCGCGGCGTGTGGCTCCTGTCGTCCTCGCCAGTCTCAGCTCAGCACACGGGCCAGCGTTTCGCTGG

TTTGGAGTCCCCGCCCTCCGGGTCCCTGACCCCGCGCCCCATTCCCGTGTTCCCAATTCTCGGTTCCAGGAATGCCTCGTGCTCGGAAGGGCAATGCGCT

CCGCAAGGGCGGTCAGCGCCGTGGAGGAG - UNI5891 - GTGCCAGGAGCAGTACCCAGGCTGACTCTGGCTCCAGTGAGGATGAAGCGGCCAGTGA

GGCCCGGAGCACCACCAGTGACTGTCCCAGCCTTCTCAGCGCCACCACAGAGGACTGCCTGG GTGGCGAAGCGGTGGACGAACAGAGCCAGCAGGAAAA

CCTGGAGGAGAAGCTGAAAGGTTATGTGGACTGCCTGACTGACAAGAG TGCCAAGACCCGTCAAGGAGCCCTGGAGAGCCTGCGCCTGGCCCTGGCCTC

CCGCCTACTTCCGGACTTTCTGCTGGAGCGCAGCCTCACTCTGGCGGATGCCCTGGAAAAGTGCCTTAAGAAAG GGAAGGGTGAAGAACAGGCTCTGGC

TGCTGCTGTGCTAGGCATTCTCTGTGTGCAGTTGGGCCCTGGACCCAAGGGCGAGGAGCTGTTCCGTAGCCTGCAGCCCTTGCTCATCTCGGTGCTCAGT

GACAGTACAGCAAGCCCCACTGCCCGGCTCCAT TGTGCTTCTGCTCTTGGCTTGGGTTGCTATGTGGCTGCCACCGACGTCCAG GACCTGGTCTCTTG

CTTGGCCTGCTTGGAAGGTGTTTTCAGCTGGTCCTGTGGCACTAGTGGCTCTGCGGCGTCTCTGGTTCCCGCCAGCCTCCATGGCCTTCTCTGTGCTGCC

CTGCAGGCCTGGGCATTGCTGCTCACCATCTGTCCTGGTACCCACATCAGCCATATCCTTGACAG GCAGCTGCCCCGGCTGCCCCAGCTCTTGTCCAGT

GAAAGTGTGAACCTGCGGATTGCTGCTGGTGAAGCCATCGCGCTACTCTTTGAGCTTGCCCGGGACCTTGAG GAGGACTTCGTCTATGAAGACATGGAG

GCCCTCTGTGGATCTCTGCGTACCCTAGCCACCGACAGCAATAAGTACCGTGCCAAGGTTGACCGGCGGCGCCAGCGCTCCATTTTCCGAGCTGTGCTGC

ACTTTGTTGAG GGTGGTGAATGTGAGGAGGAGACAGTCCGCTTCGGACTGGAAGTGCTCTACATAGACAGCTGGGCTCGCCACCGCATCTACACAGCCT

TCAAAGATGTGTTGGGCTCTGGCATACACTATCACCTCCAG AACAATGAGCTTCTCCGTGACATCTTTGGCCTGGGCCCCGTGCTAGTGTTGGATGCTG

CTGCCCTGAAGGCCTGCAAGATTTCACGCTTTGAAAAG CACCTGTACAATGCTGCAGCCTTCAAAGCCCGGACCAAGGCCCGTAGTCGTGCAAGGGACA

AGCGGGCAGATATCTTGTGAATCAGACTGGCCAACGAGAAGGCTACCCATACCATACCATATTTTTAACAGAAGACAGTGCAAGAACTGGTCCCTGCCAG

TGATTGTCACTTTATTTTTTTAATGATGAAACCAAAAATAGACAAATGTGGGAGGGTCAAGGGATCAGGACACTTAGACTCAAGCCCTTTGTATGTGCAC

TCAGCTCTGTGGCTGTGGCCTCTTCCTGTCCTGTCTCAGGTAAAACCAAATGTGTGCCGGTCCTGGAGGGCTAACGGTCCTAGAGGACTAACCTAGGACC

AACGGGCAGGGTGGGTGGTGAGAAAGGACCATCCCTGTTTTATAGACCTTGCCCCACTCCCCCACCCCCACCCCCGACCGGGGCTGCTTCCCTTGGGGGT

CTGGCACCTGGCCTCCATGGCATAGGGTAGGCAAAGCTGCCTATAATGGATGTGTGTGCTGGTTTATTAAAGATAAGAGAGAATTAAACGATACTTAGCC

CCC
Translation
MPRARKGNALRKGGQRRGGG - UNI5891 - GARSSTQADSGSSEDEAASEARSTTSDCPSLLSATTEDCLG GGEAVDEQSQQENLEEKLKGYVDCL

TDKS SAKTRQGALESLRLALASRLLPDFLLERSLTLADALEKCLKKG GKGEEQALAAAVLGILCVQLGPGPKGEELFRSLQPLLISVLSDSTASPTAR

LH CASALGLGCYVAATDVQ DLVSCLACLEGVFSWSCGTSGSAASLVPASLHGLLCAALQAWALLLTICPGTHISHILDR RQLPRLPQLLSSESVNLR

IAAGEAIALLFELARDLE EDFVYEDMEALCGSLRTLATDSNKYRAKVDRRRQRSIFRAVLHFVE GGECEEETVRFGLEVLYIDSWARHRIYTAFKDVL

GSGIHYHLQ NNELLRDIFGLGPVLVLDAAALKACKISRFEK HLYNAAAFKARTKARSRARDKRADIL

For any suggestions or comments, please send an email to unitrap@crg.es