Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000010066 (Cacna2d2)
Chromosomal location
Chr 9: 107302064 - 107431389 (+)
Description
calcium channel, voltage-dependent, alpha 2/delta subunit 2 Gene [Source:MGI Symbol;Acc:MGI:1929813]
RefSeq_peptide
NP_064659.2 
UniGene
Mm.273084 
MGI
MGI:1929813 
Uniprot/SWISSPROT
Q6PHS9 
Uniprot/SPTREMBL
B2RY16 Q920H7 
Human Ortholog
ENSG00000007402 (CACNA2D2)
Omim not available
UniTrap UNI31225
Vector Insertion
Chr 9: 107328466 - 107367883
Public Clones IST14511E10 (tigm) IST14150D11 (tigm) IST10885F5 (tigm) IST14904G11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38149
Vector Insertion
Chr 9: 107408324 - 107411525
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000010210
Sequence
CGCGGCGGGGGCGCGCGGAGGCGGGCCGGCCAAGGAGAGGGAGGGAGGGAATGAGGGAGGGAGCGACAGGGGAGGGCGGCGCCGGCAGGTTGGCGGCGGC

CGCTATTTGAGCGCAGGTCCCGGGCCAGGCGCTCAAAGCGCTTGGAGCCAGCGCGGCGGGGAGATCGCTGCGCGCAGCCCGCAGAGGCGCTGCGGCCAGT

GCAGCCCCGGAGGCCCCGCGCGGAGAAGGAGGTGGAGAAGAGGCCGGCTTTCCGCCCGCCGCCCGCGCCCCCCCACCTCCATCCCGCCGCCGCCGTCCCC

CCTCCCTCCCCGCGGCGCCGCATCTTGAATGGAAACATGGCGGTGCCGGCTCGGACCTGCGGCGCTTCTTGGCCCGGCCCGGTGCGGACCGCTCGCCCCT

GGCCCGGTCGCGGCCCCCGGCCCTGCCCTGACCCCCGGGGCCCAGCGTCCGGGCCCGCACGCCCGCTCTTGCTCTTGCTGCCGCCTCTGTTGCTTTTACC

GCTGCTCACCGCCCCCGGCGCCTCTGCCTACAGCTTCCCCCAGCAGCACAC GATGCAGCACTGGGCCCGGCGCCTGGAGCAGGAGATTGACGGTGTGAT

GCGGATTTTTGGAGGCGTGCAGCAGCTCCGAGAG - UNI31225 - ATCTACAAGGACAATCGGAACCTGTTTGAAGTGCAGGAGAATGAACCACAGA

AATTGGTGGAGAAAGTGGCAGGGGACATCGAGAGCCTGCTGGACAGGAAGGTCCAGGCCCTGAAG AGACTGGCTGACGCTGCAGAGAATTTCCAGAAAG

CCCATCGCTGGCAGGACAACATCAAG GAGGAAGACATCATGTACTACGATGCCAAGGCTGACGCCGAGCTG GATGACCCTGAGAGTGAAGATATGGAG

AGGGGATCCAAGACCAGCGCCTTAAGGCTGGACTTCATCGAGGACCCAAACTTCAAGAACAAAGTCAACTATTCATACACGGCTGTGCAGATCCCCACAG

ACATCTACAAAGGCT CTACCGTCATCCTCAATGAGCTTAACTGGACAGAGGCCCTGGAGAACGTCTTCATTGAGAACCGTAGGCAAGACCCTACACTGT

TGTGGCAAGTCTTTGGCAGTGCCACGGGAGTCACTCGCTATTACCCAG CCACACCATGGCGAGCCCCCAAGAAGATTGACCTGTACGATGTCAGAAGAC

GACCCTG GTATATACAGGGGGCCTCATCACCCAAGGACATGGTCATCATTGTGGATGT GAGTGGCAGCGTGAGCGGCCTGACTCTGAAGCTGATGAAG

ACGTCCGTCTGTGAGATGCTAGACACGCTCTCTGATGATGACTATGTGAACGTGGCCTCA TTCAACGAGAAGGCGCAGCCTGTGTCTTGCTTCACACAC

CTGGTGCAGGCCAATGTGCGTAACAAGAAGGTGTTCAAGGAAGCTGTGCAGGGCATGGTGGCCAAGGGCACCACAGGCTACAAGGCCGGCTTTGAGTATG

CCTTTGACCAGCTACAGAAT TCCAACATCACGCGGGCTAACTGCAATAAGATGATCATGATGTTCACGGATGGGGGTGAGGATCGCGTGCAGGATGTCT

TCGAAAAGTACAATTGGCCCAATCGGACG GTACGTGTGTTCACGTTCTCCGTAGGACAGCATAACTATGATGTCACACCCTTGCAGTGGATGGCCTGTA

CTAACAAAG GTTACTATTTTGAGATCCCTTCCATCGGAGCCATCCGCATCAACACACAG GAATACCTGGATGTGCTGGGTAGGCCCATGGTACTGGCA

GGCAAGGACGCCAAGCAAGTGCAATGGACAAACGTGTATGAAGATGCACTG GGGCTGGGGTTGGTGGTAACAGGAACTCTCCCTGTTTTCAACCTGACA

CAGGATGGCCCTGGGGAAAAGAAG AACCAGTTAATCCTGGGTGTCATGGGCATCGATGTGGCCTTGAATGACATCAAAAGGCTGACTCCCAACTACACA

 CTCGGCGCCAATGGCTATGTGTTCGCCATCGACCTGAACGGCTACGTGTTGCTACATCCCAATCTCAAGCCCCAG ACTACCAACTTCCGGGAGCCTGT

GACCTTGGACTTCCTGGACGCAGAGCTGGAAGATGAGAACAAGGAGGAG ATCCGTCGCAGCATGATTGACGGCGACAAAGGCCACAAGCAGATCAGAAC

CTTGGTCAAATCCCTGGATGAG AGGTACATAGACGAAGTGATTCGGAACTACACCTGGGTGCCTATAAGGAGTACCAACTACAG CCTGGGGCTGGTGC

TCCCACCCTACAGCACCTACTACCTCCAAGCCAACCTCAGCGACCAGATCCTGCAGGTCAAGT ATTTTGAGTTCCTGCTTCCCAGCAGCTTTGAGTCTG

AAGGACACGTTTTCATTGCTCCGAG AGAGTATTGCAAGGACTTGAACGCCTCGGACAACAACACCGAGTTCCTGAAGAACTTCATCGAGCTCATGGAGA

AAGTGACTCCGGACTCCAAGCAGT GTAATAACTTCCTTCTTCATAACTTGATTCTGGACACGGGCATTACACAGCAGTTAGTGGAACGTGTGTGGCGGG

ACCAAGATCTCAACAC GTACAGCCTGCTAGCCGTATTTGCTGCCACTGATGGTGGCATCACACGTGTCTTCCCGAACAA GGCAGCCGAAGACTGGACA

GAAAACCCTGAACCCTTCAATGCCAGCTTCTACCGTCGCAGCCTGGATAACCATGGTTATATCTTCAAGCCCCCACACCAGGACT CCCTGTTAAGACCA

CTGGAGCTGGAGAATGACACAGTAGGTGTCCTCGTCAGCACAGCTGTGGAGCTCAGTCTAGGTCGTCGCACACTGAGGCCAGCAG TGGTGGGTGTCAAA

CTGGACCTAGAGGCTTGGGCTGAAAAGTTCAAGGTGCTGGCCAGCAACCGTACCCATCAGGACCAACCTCAGAAG TGCGGCCCCAGCAGCCACTGTGAG

ATGGACTGCGAGGTTAACAACGAG GATCTACTCTGTGTCCTCATTGATGACGGAGGGTTCCTGGTGCTGTCAAACCAGAACCATCAGTGGGACCAG GT

TGGCAGATTCTTCAGTGAGGTGGATGCCAACCTGATGCTGGCACTGTACAATAACTCCTTCTACACCCGAAAGGAATCCTATGACTATCAGGCAGCCTGT

GCCCCTCAGCCTCCTGGGAACCTGGGTGCTGCACCCCGGGGTGTCTTTGTG CCCACCATTGCAGATTTCCTTAACTTGGCCTGGTGGACCTCTGCTGCC

GCCTG GTCCTTATTCCAGCAGCTACTCTATGGTCTCATCTATCACAGCTGGTTCCAGGCAG ACCCGGCAGAAGCTGAGGGCAGCCCCGAGACGCGCGA

GAGCAGCTGCGTCATGAAACAGACCCAGTACTACTTCGGCTCGGTGAACGCATCCTATAATGCCATCATTGACTGCGGAAACTGCAGCAG GCTGTTCCA

TGCGCAGAGACTGACCAACACCAATCTCCTGTTCGTGGTGGCCGAGAAGCCGCTGTGCAGCCAGTGCGAGGCGGGCCGGCTGCTGCAGAAGGAGACACAC

T CGGACGGCCCGGAGCAGTGTGAGCTGGTGCAGAGACCGAGATACCGAAGAGGTCCGCACATCTGTTTTGACTACAATGCGACG GAAGATACCTCAGA

CTGTGGCCGCGGAGCCTCCTTCCCTCCGTCGCTGGGCGTCTTGGTTTCCTTGCAGCTTTTGCTCCTCCTGGGCCTGCCACCTCGGCCGCAGCCTCAAGTC

CACTCCTTCGCTGCCTCTCGCCACCTCTGAGCGACCCACACACACACATCATACCCCCGCCTTGGCCTCCTAGCCTTTCGCTCACCCTCCCATTCCACAT

TCCCCAATCTAGAGCCTTGGCCACTCTCTCCTGAAGGACCTGGGTCCCTTCCCCCGGAGCCTGTGCCTTGGGGCAGGGGAACCCCAAAGTAAGGTGCCAT

GGTGTTTGGCACTCAAGATTTAGCTCACCCTTGAACTGTCCAAGTGCCCGCAGTCCCTAGACTCATCCCCGTGGGCTAGGACAGGAGGCCACTAGTACTG

ATGCCAAACCAGGCCTCCACCGACCCACCTGCCTGGAGATTTCCTCTATGTAGGCAACCCTGCCACTGCTGGGCACCTCTAACTGGCCCTTTGGCCCCAC

CCAAGCCCAAACTTACCTTCTCTGGGGGAAAAAAAAGGAAAGATGGTAATAGTGAGAGATTCGGGGGGCACCCCCTCCCCATTGGTTTCTGGCCCTTTCA

GGCTACAACCCCCCAGCCTTGCAGGTGTCAGAACAGTCTCACAATGACATCAGTTTAGACACATGCCATATACACTTGGATCTCTGAGAGCAGAAACCCA

ACTCTCACTAGACATACCTGTGATGGAACACACAAACAGACACGCACCATGGGGGGTGGCCCACAAAGCCTTACACAAGGCGAGATGTCAATGAAGGGGT

TGGCCTGTGTGTTCCATCTCTGCTCACCTCTGCCTCTACTCTGAGATGCAGCCTGGCTGATCCTCCCATCTCTAAAACTGAATGTCAAACCGTGCCAAAT

GCTGGGGGGGGGGGGAGACCTCTCTGTTTCACCCCTAGCCACCAGTGTCCCCAAGTGCCCCTCACCCTGCCAGGTGCTCATTGTAACCATCGTTCACCAG

TGTCCGGCCCCTAGTAGGACCACACATCACTGCCTGAACTCCTTTGGCAGAAGAACCCCACCAGACATTGAGACATTGTATTTTGCCTTAGCAGGGATGA

GTTGGTCTCTCCTGGCTGGGCCATCCCATCCCCAATCTGGTTCTTGCACACTCAGGCCTAATTCCCTCTGCACACACACACACACACACACACACACACA

CACACACACACACACACAGTCCCTGCCCCTAGGAGGCCAAATTACCCCTCCCTTGCTGAACACACACTTGCACCATGCACATGTCTAACCAACCGTACTG

CACACACAGAGGCTGGACCTGGGACACATCTCTTTACACCTTTCATTCTGTCATTTCTCCCAAAGGCATCGTAACTTGGGGGCCAGGAGGGGACTGAGGG

GCAGGGGGGAGGGGTGTAGCTGTGAGGCTCAGATGGACTGGGAGGAGGGGGGAGGGTGATACATTAATTAATGGCTTCGTTAATTAATGTCATGTTGCTT

GTTGCTTTCTCAGTGTGTGTATGGTCCATGCCCAGTGCTGGTGACAGGGTGGGTATCCATGATGTGTGCCCAGCCTGGATGTCAGCTGTGTCCTGTGGGG

GCGTGTGTGTAACTGTAGTGTAGTCAGGTGCTCAACGGAGAATATAAACAAAAAAAAAAGAAACAAACGTATACAGAAAAATAAATATATATTTTAAGTT

TAAAGACAAATGAAACCAGACAAA
Translation
 MRIFGGVQQLRE - UNI31225 - IYKDNRNLFEVQENEPQKLVEKVAGDIESLLDRKVQALK RLADAAENFQKAHRWQDNIK EEDIMYYDAKAD

AEL DDPESEDMERGSKTSALRLDFIEDPNFKNKVNYSYTAVQIPTDIYKGS STVILNELNWTEALENVFIENRRQDPTLLWQVFGSATGVTRYYPA A

TPWRAPKKIDLYDVRRRPW WYIQGASSPKDMVIIVDV VSGSVSGLTLKLMKTSVCEMLDTLSDDDYVNVAS FNEKAQPVSCFTHLVQANVRNKKVFK

EAVQGMVAKGTTGYKAGFEYAFDQLQN SNITRANCNKMIMMFTDGGEDRVQDVFEKYNWPNRT VRVFTFSVGQHNYDVTPLQWMACTNKG GYYFEIP

SIGAIRINTQ EYLDVLGRPMVLAGKDAKQVQWTNVYEDAL GLGLVVTGTLPVFNLTQDGPGEKK NQLILGVMGIDVALNDIKRLTPNYT LGANGYV

FAIDLNGYVLLHPNLKPQ TTNFREPVTLDFLDAELEDENKEE IRRSMIDGDKGHKQIRTLVKSLDE RYIDEVIRNYTWVPIRSTNYS SLGLVLPPY

STYYLQANLSDQILQVKY YFEFLLPSSFESEGHVFIAPR REYCKDLNASDNNTEFLKNFIELMEKVTPDSKQC CNNFLLHNLILDTGITQQLVERVW

RDQDLNT TYSLLAVFAATDGGITRVFPNK KAAEDWTENPEPFNASFYRRSLDNHGYIFKPPHQDS SLLRPLELENDTVGVLVSTAVELSLGRRTLRP

AV VVGVKLDLEAWAEKFKVLASNRTHQDQPQK CGPSSHCEMDCEVNNE DLLCVLIDDGGFLVLSNQNHQWDQ VGRFFSEVDANLMLALYNNSFYTR

KESYDYQAACAPQPPGNLGAAPRGVFV PTIADFLNLAWWTSAAAW WSLFQQLLYGLIYHSWFQAD DPAEAEGSPETRESSCVMKQTQYYFGSVNASY

NAIIDCGNCSR RLFHAQRLTNTNLLFVVAEKPLCSQCEAGRLLQKETHS SDGPEQCELVQRPRYRRGPHICFDYNAT EDTSDCGRGASFPPSLGVLV

SLQLLLLLGLPPRPQPQVHSFAASRHL
Transcript ENSMUST00000085092
Sequence
CGCGGCGGGGGCGCGCGGAGGCGGGCCGGCCAAGGAGAGGGAGGGAGGGAATGAGGGAGGGAGCGACAGGGGAGGGCGGCGCCGGCAGGTTGGCGGCGGC

CGCTATTTGAGCGCAGGTCCCGGGCCAGGCGCTCAAAGCGCTTGGAGCCAGCGCGGCGGGGAGATCGCTGCGCGCAGCCCGCAGAGGCGCTGCGGCCAGT

GCAGCCCCGGAGGCCCCGCGCGGAGAAGGAGGTGGAGAAGAGGCCGGCTTTCCGCCCGCCGCCCGCGCCCCCCCACCTCCATCCCGCCGCCGCCGTCCCC

CCTCCCTCCCCGCGGCGCCGCATCTTGAATGGAAACATGGCGGTGCCGGCTCGGACCTGCGGCGCTTCTTGGCCCGGCCCGGTGCGGACCGCTCGCCCCT

GGCCCGGTCGCGGCCCCCGGCCCTGCCCTGACCCCCGGGGCCCAGCGTCCGGGCCCGCACGCCCGCTCTTGCTCTTGCTGCCGCCTCTGTTGCTTTTACC

GCTGCTCACCGCCCCCGGCGCCTCTGCCTACAGCTTCCCCCAGCAGCACAC GATGCAGCACTGGGCCCGGCGCCTGGAGCAGGAGATTGACGGTGTGAT

GCGGATTTTTGGAGGCGTGCAGCAGCTCCGAGAG - UNI31225 - ATCTACAAGGACAATCGGAACCTGTTTGAAGTGCAGGAGAATGAACCACAGA

AATTGGTGGAGAAAGTGGCAGGGGACATCGAGAGCCTGCTGGACAGGAAGGTCCAGGCCCTGAAG AGACTGGCTGACGCTGCAGAGAATTTCCAGAAAG

CCCATCGCTGGCAGGACAACATCAAG GAGGAAGACATCATGTACTACGATGCCAAGGCTGACGCCGAGCTG GATGACCCTGAGAGTGAAGATATGGAG

AGGGGATCCAAGACCAGCGCCTTAAGGCTGGACTTCATCGAGGACCCAAACTTCAAGAACAAAGTCAACTATTCATACACGGCTGTGCAGATCCCCACAG

ACATCTACAAAGGCT CTACCGTCATCCTCAATGAGCTTAACTGGACAGAGGCCCTGGAGAACGTCTTCATTGAGAACCGTAGGCAAGACCCTACACTGT

TGTGGCAAGTCTTTGGCAGTGCCACGGGAGTCACTCGCTATTACCCAG CCACACCATGGCGAGCCCCCAAGAAGATTGACCTGTACGATGTCAGAAGAC

GACCCTG GTATATACAGGGGGCCTCATCACCCAAGGACATGGTCATCATTGTGGATGT GAGTGGCAGCGTGAGCGGCCTGACTCTGAAGCTGATGAAG

ACGTCCGTCTGTGAGATGCTAGACACGCTCTCTGATGATGACTATGTGAACGTGGCCTCA TTCAACGAGAAGGCGCAGCCTGTGTCTTGCTTCACACAC

CTGGTGCAGGCCAATGTGCGTAACAAGAAGGTGTTCAAGGAAGCTGTGCAGGGCATGGTGGCCAAGGGCACCACAGGCTACAAGGCCGGCTTTGAGTATG

CCTTTGACCAGCTACAGAAT TCCAACATCACGCGGGCTAACTGCAATAAGATGATCATGATGTTCACGGATGGGGGTGAGGATCGCGTGCAGGATGTCT

TCGAAAAGTACAATTGGCCCAATCGGACG GTACGTGTGTTCACGTTCTCCGTAGGACAGCATAACTATGATGTCACACCCTTGCAGTGGATGGCCTGTA

CTAACAAAG GTTACTATTTTGAGATCCCTTCCATCGGAGCCATCCGCATCAACACACAG GAATACCTGGATGTGCTGGGTAGGCCCATGGTACTGGCA

GGCAAGGACGCCAAGCAAGTGCAATGGACAAACGTGTATGAAGATGCACTG GGGCTGGGGTTGGTGGTAACAGGAACTCTCCCTGTTTTCAACCTGACA

CAGGATGGCCCTGGGGAAAAGAAG AACCAGTTAATCCTGGGTGTCATGGGCATCGATGTGGCCTTGAATGACATCAAAAGGCTGACTCCCAACTACACA

 CTCGGCGCCAATGGCTATGTGTTCGCCATCGACCTGAACGGCTACGTGTTGCTACATCCCAATCTCAAGCCCCAG ACTACCAACTTCCGGGAGCCTGT

GACCTTGGACTTCCTGGACGCAGAGCTGGAAGATGAGAACAAGGAGGAG ATCCGTCGCAGCATGATTGACGGCGACAAAGGCCACAAGCAGATCAGAAC

CTTGGTCAAATCCCTGGATGAG AGGTACATAGACGAAGTGATTCGGAACTACACCTGGGTGCCTATAAGGAGTACCAACTACAG CCTGGGGCTGGTGC

TCCCACCCTACAGCACCTACTACCTCCAAGCCAACCTCAGCGACCAGATCCTGCAGGTCAAGT TGCCAATCAGCAAACTGAAGG ATTTTGAGTTCCTG

CTTCCCAGCAGCTTTGAGTCTGAAGGACACGTTTTCATTGCTCCGAG AGAGTATTGCAAGGACTTGAACGCCTCGGACAACAACACCGAGTTCCTGAAG

AACTTCATCGAGCTCATGGAGAAAGTGACTCCGGACTCCAAGCAGT GTAATAACTTCCTTCTTCATAACTTGATTCTGGACACGGGCATTACACAGCAG

TTAGTGGAACGTGTGTGGCGGGACCAAGATCTCAACAC GTACAGCCTGCTAGCCGTATTTGCTGCCACTGATGGTGGCATCACACGTGTCTTCCCGAAC

AA GGCAGCCGAAGACTGGACAGAAAACCCTGAACCCTTCAATGCCAGCTTCTACCGTCGCAGCCTGGATAACCATGGTTATATCTTCAAGCCCCCACAC

CAGGACT CCCTGTTAAGACCACTGGAGCTGGAGAATGACACAGTAGGTGTCCTCGTCAGCACAGCTGTGGAGCTCAGTCTAGGTCGTCGCACACTGAGG

CCAGCAG TGGTGGGTGTCAAACTGGACCTAGAGGCTTGGGCTGAAAAGTTCAAGGTGCTGGCCAGCAACCGTACCCATCAGGACCAACCTCAGAAG TG

CGGCCCCAGCAGCCACTGTGAGATGGACTGCGAGGTTAACAACGAG GATCTACTCTGTGTCCTCATTGATGACGGAGGGTTCCTGGTGCTGTCAAACCA

GAACCATCAGTGGGACCAG GTTGGCAGATTCTTCAGTGAGGTGGATGCCAACCTGATGCTGGCACTGTACAATAACTCCTTCTACACCCGAAAGGAATC

CTATGACTATCAGGCAGCCTGTGCCCCTCAGCCTCCTGGGAACCTGGGTGCTGCACCCCGGGGTGTCTTTGTG CCCACCATTGCAGATTTCCTTAACTT

GGCCTGGTGGACCTCTGCTGCCGCCTG GTCCTTATTCCAGCAGCTACTCTATGGTCTCATCTATCACAGCTGGTTCCAGGCAG ACCCGGCAGAAGCTG

AGGGCAGCCCCGAGACGCGCGAGAGCAGCTGCGTCATGAAACAGACCCAGTACTACTTCGGCTCGGTGAACGCATCCTATAATGCCATCATTGACTGCGG

AAACTGCAGCAG GCTGTTCCATGCGCAGAGACTGACCAACACCAATCTCCTGTTCGTGGTGGCCGAGAAGCCGCTGTGCAGCCAGTGCGAGGCGGGCCG

GCTGCTGCAGAAGGAGACACACT GCCCAGCGGACGGCCCGGAGCAGTGTGAGCTGGTGCAGAGACCGAGATACCGAAGAGGTCCGCACATCTGTTTTGA

CTACAATGCGACG GAAGATACCTCAGACTGTGGCCGCGGAGCCTCCTTCCCTCCGTCGCTGGGCGTCTTGGTTTCCTTGCAGCTTTTGCTCCTCCTGGG

CCTGCCACCTCGGCCGCAGCCTCAAGTCCACTCCTTCGCTGCCTCTCGCCACCTCTGAGCGACCCACACACACACATCATACCCCCGCCTTGGCCTCCTA

GCCTTTCGCTCACCCTCCCATTCCACATTCCCCAATCTAGAGCCTTGGCCACTCTCTCCTGAAGGACCTGGGTCCCTTCCCCCGGAGCCTGTGCCTTGGG

GCAGGGGAACCCCAAAGTAAGGTGCCATGGTGTTTGGCACTCAAGATTTAGCTCACCCTTGAACTGTCCAAGTGCCCGCAGTCCCTAGACTCATCCCCGT

GGGCTAGGACAGGAGGCCACTAGTACTGATGCCAAACCAGGCCTCCACCGACCCACCTGCCTGGAGATTTCCTCTATGTAGGCAACCCTGCCACTGCTGG

GCACCTCTAACTGGCCCTTTGGCCCCACCCAAGCCCAAACTTACCTTCTCTGGGGGAAAAAAAAGGAAAGATGGTAATAGTGAGAGATTCGGGGGGCACC

CCCTCCCCATTGGTTTCTGGCCCTTTCAGGCTACAACCCCCCAGCCTTGCAGGTGTCAGAACAGTCTCACAATGACATCAGTTTAGACACATGCCATATA

CACTTGGATCTCTGAGAGCAGAAACCCAACTCTCACTAGACATACCTGTGATGGAACACACAAACAGACACGCACCATGGGGGGTGGCCCACAAAGCCTT

ACACAAGGCGAGATGTCAATGAAGGGGTTGGCCTGTGTGTTCCATCTCTGCTCACCTCTGCCTCTACTCTGAGATGCAGCCTGGCTGATCCTCCCATCTC

TAAAACTGAATGTCAAACCGTGCCAAATGCTGGGGGGGGGGGGAGACCTCTCTGTTTCACCCCTAGCCACCAGTGTCCCCAAGTGCCCCTCACCCTGCCA

GGTGCTCATTGTAACCATCGTTCACCAGTGTCCGGCCCCTAGTAGGACCACACATCACTGCCTGAACTCCTTTGGCAGAAGAACCCCACCAGACATTGAG

ACATTGTATTTTGCCTTAGCAGGGATGAGTTGGTCTCTCCTGGCTGGGCCATCCCATCCCCAATCTGGTTCTTGCACACTCAGGCCTAATTCCCTCTGCA

CACACACACACACACACACACACACACACACACACACACACACACAGTCCCTGCCCCTAGGAGGCCAAATTACCCCTCCCTTGCTGAACACACACTTGCA

CCATGCACATGTCTAACCAACCGTACTGCACACACAGAGGCTGGACCTGGGACACATCTCTTTACACCTTTCATTCTGTCATTTCTCCCAAAGGCATCGT

AACTTGGGGGCCAGGAGGGGACTGAGGGGCAGGGGGGAGGGGTGTAGCTGTGAGGCTCAGATGGACTGGGAGGAGGGGGGAGGGTGATACATTAATTAAT

GGCTTCGTTAATTAATGTCATGTTGCTTGTTGCTTTCTCAGTGTGTGTATGGTCCATGCCCAGTGCTGGTGACAGGGTGGGTATCCATGATGTGTGCCCA

GCCTGGATGTCAGCTGTGTCCTGTGGGGGCGTGTGTGTAACTGTAGTGTAGTCAGGTGCTCAACGGAGAATATAAACAAAAAAAAAAGAAACAAACGTAT

ACAGAAAAATAAATATATATTTTAAGTTTAAAGACAAATGAAACCAGACAAA
Translation
MAVPARTCGASWPGPVRTARPWPGRGPRPCPDPRGPASGPARPLLLLLPPLLLLPLLTAPGASAYSFPQQHT TMQHWARRLEQEIDGVMRIFGGVQQLR

E - UNI31225 - IYKDNRNLFEVQENEPQKLVEKVAGDIESLLDRKVQALK RLADAAENFQKAHRWQDNIK EEDIMYYDAKADAEL DDPESEDM

ERGSKTSALRLDFIEDPNFKNKVNYSYTAVQIPTDIYKGS STVILNELNWTEALENVFIENRRQDPTLLWQVFGSATGVTRYYPA ATPWRAPKKIDLY

DVRRRPW WYIQGASSPKDMVIIVDV VSGSVSGLTLKLMKTSVCEMLDTLSDDDYVNVAS FNEKAQPVSCFTHLVQANVRNKKVFKEAVQGMVAKGTT

GYKAGFEYAFDQLQN SNITRANCNKMIMMFTDGGEDRVQDVFEKYNWPNRT VRVFTFSVGQHNYDVTPLQWMACTNKG GYYFEIPSIGAIRINTQ E

YLDVLGRPMVLAGKDAKQVQWTNVYEDAL GLGLVVTGTLPVFNLTQDGPGEKK NQLILGVMGIDVALNDIKRLTPNYT LGANGYVFAIDLNGYVLLH

PNLKPQ TTNFREPVTLDFLDAELEDENKEE IRRSMIDGDKGHKQIRTLVKSLDE RYIDEVIRNYTWVPIRSTNYS SLGLVLPPYSTYYLQANLSDQ

ILQVKL LPISKLKD DFEFLLPSSFESEGHVFIAPR REYCKDLNASDNNTEFLKNFIELMEKVTPDSKQC CNNFLLHNLILDTGITQQLVERVWRDQ

DLNT TYSLLAVFAATDGGITRVFPNK KAAEDWTENPEPFNASFYRRSLDNHGYIFKPPHQDS SLLRPLELENDTVGVLVSTAVELSLGRRTLRPAV 

VVGVKLDLEAWAEKFKVLASNRTHQDQPQK CGPSSHCEMDCEVNNE DLLCVLIDDGGFLVLSNQNHQWDQ VGRFFSEVDANLMLALYNNSFYTRKES

YDYQAACAPQPPGNLGAAPRGVFV PTIADFLNLAWWTSAAAW WSLFQQLLYGLIYHSWFQAD DPAEAEGSPETRESSCVMKQTQYYFGSVNASYNAI

IDCGNCSR RLFHAQRLTNTNLLFVVAEKPLCSQCEAGRLLQKETHC CPADGPEQCELVQRPRYRRGPHICFDYNAT EDTSDCGRGASFPPSLGVLVS

LQLLLLLGLPPRPQPQVHSFAASRHL

For any suggestions or comments, please send an email to unitrap@crg.es